(data stored in ACNUC7421 zone)

EMBL: CP001700.PE109

CP001700.PE109       Location/Qualifiers
FT   CDS_pept        complement(111609..113939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0109"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: tfu:Tfu_0250 PAS containing protein
FT                   phosphatase 2C-like; TIGRFAM: PAS sensor protein; PFAM:
FT                   Stage II sporulation E family protein; PAS fold domain
FT                   protein; GAF domain protein; PAS fold-4 domain protein;
FT                   SMART: protein phosphatase 2C domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69064"
FT                   /db_xref="GOA:C7QHC5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACU69064.1"
FT                   /translation="MRRQPGTGEQLPHARPQPSAELVPANSTQTSAISVLEALPDPVVV
FT                   LNHRGQITGWNPAAEELFGWYGEEVLGRPWTEFVVADGTNGNALSHLDSIGSTVQRGGT
FT                   WEGSFPITTRNGDSLLARVRAAPMMSGGMITGTVVTAIDLFGSDASRDDQQRAAARAAV
FT                   RAAVLSRAGMQLGTSLDTGRTLAALAEILVPAFADTCVVDLLDENGVAQRLVTVHSTDT
FT                   APCPPMRSGTEIHYPARHPCDRALRTGRPVLIQGAPRVKALDQDEECDRKSLLLDAKSL
FT                   IAVPLLAPSGVRGVLAIALTEDADPTPRYDTADLELVEELAARAGLALENAAMFDRQRT
FT                   LALALQKSLLPTDLPLPDGVSIRVGYAPGAASEVSGDLYDVVELSAGRIGVVIGDVQGR
FT                   GAHAAAVMGQLRAALRAYAVLDVQPGQLLSYLDELVRGLNEEILVTCVYAIYDPFTRRC
FT                   ALANAGHPPPLLASAHGTYPMEVPPDVPLGIGPLGPGGGKGAVQFEDHIFSIPPGDVLV
FT                   MYTDGVVERRDQSVDTGVRTLCLAIERVVREPRAICRAALRAAGSEAHDDQAVLAMATS
FT                   TVDLPLSRLALPARPEAAFAARHHTRAVLREWGLSEHAELAELLVSELITNAVRHASGP
FT                   RPTPWSFSDSDQYSDPEPPPMAEDMMELAAVREYADHLGALDEENELDLLAEPGLLDEL
FT                   GMLDGTLAAPGGSRRLDLVLRRGLRALWIEVHDPDVRLPRIRQAAETDEGGRGLYLVDA
FT                   LSARWGARPTDAGKFVWFEIPLF"
     atgcgacgtc agccggggac cggggaacag ctcccgcacg cccggccgca gccctccgcc        60
     gagctcgtcc cggcgaacag cacccagacc tcggcgatct cggtgctgga ggctctgccc       120
     gaccccgtgg tggtgctgaa ccaccgggga cagatcaccg gctggaaccc cgccgccgag       180
     gagctcttcg gctggtacgg ggaagaggtg ctgggccggc cgtggaccga gttcgtggtc       240
     gccgacggca ccaacggcaa cgctctgtca cacctggact ccatcgggtc gaccgtccag       300
     cgcggcggga cctgggaggg ctccttcccg atcaccacgc gcaacggcga ctcgctgctg       360
     gcccgggtgc gcgccgcgcc gatgatgtcc ggcggcatga tcaccggcac cgtggtgacc       420
     gcgatcgacc tgttcggctc cgacgccagc cgcgacgacc agcagcgcgc cgccgcacgg       480
     gccgctgtgc gcgccgcggt gctgtcgcgc gcggggatgc agctggggac ctcgctggac       540
     accggacgga cgctcgccgc gctggcggag atcttggttc cggcgttcgc cgacacctgt       600
     gtcgtggacc tgctggatga gaacggcgtc gcgcagcgcc tggtgacggt gcacagtacg       660
     gacactgctc cgtgtcctcc tatgcgttcg ggtacggaga tccactaccc ggcgcgccat       720
     ccttgtgacc gcgcgctgcg gaccggacgt ccggttctca ttcagggcgc accgcgagtc       780
     aaggcgctgg accaggacga ggagtgcgac cgcaagtcgc tcctgctgga cgcgaagtca       840
     ctgatcgctg ttccgctcct ggcgcctagc ggagtgcgcg gagtcctcgc catcgcgctt       900
     accgaggacg ccgacccgac gccccggtac gacacggcgg acctggagct tgtcgaggag       960
     ctggcggcgc gggccgggct ggccctggag aacgcggcca tgttcgaccg gcagcggact      1020
     ctggcgctgg cgttgcagaa gtcgctcctg ccgaccgact tgccgctccc tgacggcgtc      1080
     tccatccgcg tgggctatgc cccgggtgcc gcctctgaag tcagcggtga cttgtatgac      1140
     gtcgtcgagc tgtccgccgg acggatcggc gtggtcatcg gggacgtgca gggacgcggt      1200
     gcgcacgccg ccgctgtgat gggacagttg cgcgccgcct tgcgtgccta cgcagtgctg      1260
     gatgtgcagc ccggacagtt gctgtcgtat ctggacgagt tggtccgcgg gctgaacgag      1320
     gagatcctcg tcacctgtgt atatgccatc tatgacccct tcacccggcg ctgcgctcta      1380
     gcgaacgccg gacacccgcc gcccttgttg gcttccgcgc acgggactta tccgatggag      1440
     gtcccgccgg acgtcccgtt gggcatcggt ccgctgggtc ccggcggcgg caagggtgcc      1500
     gtgcagttcg aggaccacat cttcagcatc cctcctgggg acgtactggt gatgtacacg      1560
     gacggggtcg tggagcggcg cgaccagtcg gtggacaccg gtgtccgcac actgtgtctg      1620
     gccatcgagc gcgtggtgcg cgagcctcgg gcgatctgcc gggcggctct gcgggccgcc      1680
     ggtagcgagg cgcacgacga ccaggctgtg ctcgccatgg cgacctcgac tgtcgacctc      1740
     ccgctgtcgc gtctggcgct gccggcgcgt ccggaggcgg cgttcgccgc ccggcaccac      1800
     acccgggccg tgctgcgcga gtggggtctg agcgagcacg cggagctggc cgagctgctg      1860
     gtctccgagc tgatcacgaa cgcggtgcgg cacgcgagcg gtccgcggcc gactccgtgg      1920
     tccttctccg actccgacca gtactccgat cccgagccgc cgcccatggc cgaggacatg      1980
     atggagctgg cggccgtccg ggagtacgcc gaccacctcg gcgccctgga cgaggagaac      2040
     gagttggacc tgctcgccga gcccggcttg ctggacgagc tggggatgct ggacggcacc      2100
     ctggccgcgc ccggcggttc gcggcggctg gacctggtgc tgcggcgcgg gctgcgggcg      2160
     ctgtggatcg aggtgcacga cccggacgtg cggctgcccc gcatccggca ggccgcggaa      2220
     acagatgagg gcggccgcgg gttgtatctg gtggacgcgc tgtcggcgcg gtggggcgcg      2280
     cggcccaccg atgcgggcaa gttcgtctgg ttcgagatcc cgctgttctg a               2331
//

If you have problems or comments...

PBIL Back to PBIL home page