(data stored in ACNUC7421 zone)

EMBL: CP001700.PE11

CP001700.PE11        Location/Qualifiers
FT   CDS_pept        complement(14928..15650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0011"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: saq:Sare_0152 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68966"
FT                   /db_xref="GOA:C7QFM7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM7"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACU68966.1"
FT                   /translation="MKRVDDRPQHARIAADLRAKILAGDITGTLPPFKRLMELYSTTTN
FT                   TAQRAVALLKAEGFVEGQRGKALIIRADRIRIVDAASQFEPPASTITYQILHIGPARPP
FT                   ADAAQKLGLAEGETALLRKRLMLRDEEPVEIEWSFYPESVVTGTALDKPLPQRDLATAP
FT                   TVLAALGWKQAGLVDEIQVREPTTEELQTLELPDEIPVMRTLRTITDAEGTVLEVTVMI
FT                   TSGHLYGVRYQQKLTPPA"
     atgaagcgcg tcgacgaccg gccgcaacac gcacggatcg ccgccgacct gcgcgcgaag        60
     atcctcgccg gcgacatcac gggcacactc ccgcccttca aacgcctgat ggagctctac       120
     agcacgacca ccaacaccgc ccaaagagcc gtcgcactgc tcaaggcaga gggcttcgtc       180
     gagggccagc ggggcaaagc cctgatcatc cgcgccgacc gcatcaggat cgtcgacgcc       240
     gcgtcccagt tcgagccgcc ggccagcacc atcacctacc agatcctgca catcggcccg       300
     gcacgcccac cagcggacgc cgcccagaaa ctgggcctgg ccgaaggcga gacagcgctg       360
     ctccgcaagc gcctgatgct ccgcgacgaa gaaccggtcg agatcgagtg gtccttctac       420
     ccggaatcag tcgtcaccgg aaccgccctc gacaagccac tcccgcagcg cgacctggcc       480
     accgcgccaa cagtcctggc agccctgggc tggaagcaag ccggcctcgt cgacgaaatc       540
     caagtccgcg agcccacgac cgaagaactc cagacgctgg aactccccga cgagatcccg       600
     gtcatgcgca cactgcgcac gatcaccgat gccgaaggca cggtgctcga ggtcacggtc       660
     atgattacga gcggccacct gtacggcgtg cgctaccagc agaagctgac gccgcccgcg       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page