(data stored in ACNUC7421 zone)

EMBL: CP001700.PE110

CP001700.PE110       Location/Qualifiers
FT   CDS_pept        complement(114008..114655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0110"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   sco:SCO3183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69065"
FT                   /db_xref="GOA:C7QHC6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC6"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACU69065.1"
FT                   /translation="MTNQFNEPGLAKGTIRSRLLAARRAYAPELRAAWAATACEVLVGQ
FT                   MSGADVVAAYASFGTEPDTGPLLAELRGRGIRVLLPILENDMDLSWGRYSGPDSLVRRI
FT                   PPGGSAPGPIPEPAESLGLDAVLSASWIVVPALAVSPAGIRMGRGGGSYDRVLTRIEAS
FT                   PRGARPRVAALLYPGELGVDIPVEPHDRAVDMAVAGESVRHWDESPGGVLSR"
     atgacgaatc aattcaacga gccgggcctt gccaagggca cgatccggtc acggttgctg        60
     gccgctcggc gcgcgtacgc ccccgagctg cgcgcagcgt gggccgcgac ggcgtgcgaa       120
     gtgctggtgg gacagatgag cggggcggac gtggtcgccg cctacgcctc cttcggcacc       180
     gagccggaca ccggcccgtt gctggcggaa ttgcgcgggc ggggtatccg cgtcctgtta       240
     cctattctag agaatgacat ggacctgtcg tgggggcggt actcaggccc tgattcactc       300
     gttcgaagga tccctccggg cggctccgcc cccggaccga tccccgagcc cgccgagtcg       360
     ctgggtctgg acgcggtgtt gtcagcctcc tggatcgtgg tccccgccct ggccgtctcg       420
     cccgccggga tccgcatggg acgcggcggc ggcagctacg accgggtgct gaccaggatc       480
     gaggcgtccc cgcgcggtgc gcgcccccgg gtcgcggccc tgctctaccc cggcgagctc       540
     ggcgtggaca tcccggtcga gccgcacgat cgcgccgtcg acatggcggt cgccggggaa       600
     agcgttcgcc actgggacga atctcccggc ggggttctct cgcgctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page