(data stored in ACNUC7421 zone)

EMBL: CP001700.PE111

CP001700.PE111       Location/Qualifiers
FT   CDS_pept        114697..115383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0111"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: ace:Acel_0165 diguanylate cyclase with GAF
FT                   sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69066"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACU69066.1"
FT                   /translation="MSLTAVVLVLLAAAAVALAGMNLALRRRLEHLEETTRTALAQAAS
FT                   EVTGLEQGREDLERLSALDPLTGVWNYRYLQGALGRELEAARATGIGGALLMIDVDDFR
FT                   RVNAGYGHQRGSAVLRELAQRLALEVRHADTFARYGGEEFVLILPGTNADTAAKVAERL
FT                   CYAVRKLTFDAGPDTDSEQGPFQLTISVGGVIFPDHGTHAATLLRVADEQLMAAKRDSH
FT                   GSWRIT"
     atgtctctca cggcggtggt cttggtgttg ctggcggcgg ccgcggtcgc cttggccggc        60
     atgaacctgg ccctgcgccg gcggctggag cacctggagg agaccactcg cacggccctg       120
     gctcaggccg ccagcgaggt gaccgggctg gagcagggcc gtgaggacct ggagcggctg       180
     tcggcgctcg atccgctgac cggagtgtgg aactaccgct atctgcaggg cgcgctgggc       240
     cgggaactcg aggccgctcg ggccaccggg ataggcggcg cgctgctgat gatcgacgtc       300
     gacgacttcc gccgggtcaa cgccggatac ggacaccagc gcggctccgc cgttctccgc       360
     gagctggcgc agcgtttggc gctggaagtg cgacacgccg acactttcgc cagatacggc       420
     ggcgaggagt tcgtcctcat cctgccgggc accaacgccg acaccgccgc gaaggtggcc       480
     gagcggctct gttacgccgt ccgcaaactc accttcgacg caggtccgga cacagactcc       540
     gaacaaggcc cgttccagct gacgatctcc gtcggcggtg tgatcttccc cgatcacggg       600
     acgcacgccg cgacgctgtt gcgcgtcgct gatgaacaac tcatggcagc taaacgagac       660
     tctcatggaa gttggcgcat cacctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page