(data stored in ACNUC7421 zone)

EMBL: CP001700.PE112

CP001700.PE112       Location/Qualifiers
FT   CDS_pept        115398..116318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0112"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   sma:SAV_3673 UTP:glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69067"
FT                   /db_xref="GOA:C7QHC8"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC8"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ACU69067.1"
FT                   /translation="MVEVRKAVIPSAGLGTRFLPATKATPKEMLPVIDKPTIQYVVEEA
FT                   VTAGLTDILMVTGRNKRPLEDHFDRAAELEEALEAKGDKVRLQQVRASAEMANVHYVRQ
FT                   GDPKGLGHAVLKAESYVHGEPFAVLLGDDFIDERDPLLPAMIAVRQRYGGSVVGLIEVP
FT                   EEQIHMYGCAAVKPAVDGPDLGHDHTSLIQITDLVEKPSVAQAPSNLAVIGRYVLDPAV
FT                   MGVLRETAPGRGGEIQLTDALRTLAGDPDIGGPVHGVVFTGRRYDTGNPIDYLKTVVQL
FT                   AVDRPDLGGEFRDWLSSYVRAGFHD"
     atggtggagg ttcgcaaagc agtcatccca tcggcgggtc tgggcaccag attcctgccg        60
     gcgaccaagg cgacacccaa ggagatgctc ccggtcatcg acaagccgac gatccagtac       120
     gtcgtcgagg aggccgtgac cgcggggctg accgacatcc tcatggtgac cggccgcaac       180
     aagcggccgt tggaagacca cttcgaccgc gccgcggagc tcgaggaggc gctggaggcc       240
     aagggcgaca aagtccggct gcagcaggtc cgggcgtccg cggagatggc aaacgtccac       300
     tatgtccggc agggcgaccc caagggtctg ggccacgccg tcctgaaggc cgagtcctat       360
     gtgcacggcg agccgttcgc cgttctgctc ggcgacgact tcatcgacga gcgcgacccg       420
     ctgctgccgg ccatgatcgc cgtccggcag cgctacggcg gttccgtggt cggcctgatc       480
     gaggttcccg aagagcagat ccacatgtac ggctgcgccg cggtgaagcc agcggtggac       540
     ggaccagacc tgggccacga tcacaccagc ctgatccaga tcaccgatct ggtggagaag       600
     ccctcagtcg cgcaggctcc gtcgaacctc gcggtgatcg gccgctatgt gctggacccc       660
     gccgtcatgg gcgtcctgcg cgagaccgct ccgggacgcg gcggggagat ccagctgacc       720
     gacgcgctgc ggaccctggc aggcgacccg gacatcggcg gaccggtcca cggtgtggtg       780
     ttcaccgggc gccggtacga caccggtaac ccgatcgact acttgaagac cgtcgtgcag       840
     ctcgcggtcg accgtcccga cctcggtggg gaattccgtg actggctgtc gtcctatgtg       900
     cgcgcgggct tccacgactg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page