(data stored in ACNUC7421 zone)

EMBL: CP001700.PE113

CP001700.PE113       Location/Qualifiers
FT   CDS_pept        116350..117591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0113"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: ace:Acel_0167 molybdopterin molybdochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69068"
FT                   /db_xref="GOA:C7QHC9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC9"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU69068.1"
FT                   /translation="MSDSENARMRSVDDHLKTVLDTVQLLAPMELPITDVNGLVLAEDV
FT                   VSAISLPPFDNSSVDGYAVRLADLEGAAEDSPAELRVLGDVAAGSVHEGILEPGTCLRI
FT                   MTGAMVPHGAEAVVPVEWTDGGTESVRITRVPERDEHIRVLGSDVAAGDVVLKAGTRLG
FT                   PRQIGLLAAIGQVHAPVHPHPRVVVLSTGSELVEPGTPLGPGQINDGNGPALTAAVNAM
FT                   GATGIRVGIIGDDPQGVLDAIEDQLIRADMVVTTGGVSVGAYDVVKEVLSTLGTVEFTK
FT                   VAMQPGMPQGFGTVGEDRIPIFTLPGNPVSAYVSFEIYIRPAIEKMMGIETGPRETVTA
FT                   TCFGAFTSPSGKRQFARGIYDPHGLSVRPVGGHGSHLVGDLALANALIVVPEYVTEVVD
FT                   GDDVEVIVMEGGPR"
     atgtccgatt ccgagaacgc gaggatgcgc agtgtcgacg accacctcaa gacggtcctc        60
     gacactgtgc aactcctcgc cccgatggaa ctcccgatca ccgatgtgaa cgggctggtg       120
     ctcgccgagg acgtcgtctc ggcgatctcg ctgccgccgt tcgacaactc ctcggtggac       180
     ggctacgcgg tgcggctggc cgacctggag ggcgccgccg aggacagccc ggcggagctg       240
     cgggtgctcg gcgacgtcgc ggccggctcg gtccacgagg gcatcctgga gccggggacg       300
     tgcctgcgga tcatgaccgg cgcgatggtg ccgcacggcg ccgaagcggt cgtgccggtg       360
     gagtggaccg acggcggcac ggagagcgtg cgtatcaccc gggtcccgga gcgcgacgag       420
     cacatccgcg tcctcggttc ggacgtggcg gccggcgacg tggtgctcaa ggccggcacc       480
     cgcctcggcc cgcgccagat cggcctgctc gccgcgatcg gccaggtcca cgccccggtg       540
     cacccgcacc cgcgggttgt ggtgctgtcc accggctcgg agctggtcga gcccggcacg       600
     ccgctgggcc cgggccagat caacgacggc aacggcccgg cgctgaccgc cgcggtgaac       660
     gccatgggcg cgaccggcat ccgggtcggc atcatcggcg acgacccgca gggtgtgctc       720
     gacgcgatcg aggaccagct gatccgcgcc gacatggtgg tcaccaccgg cggggtctcg       780
     gtcggcgcct acgacgtggt gaaggaggtg ctctccacac tgggcaccgt ggagttcacc       840
     aaggtcgcga tgcagccggg gatgccgcag ggcttcggca cggtcggcga ggaccggatc       900
     ccgatcttca cgctgccggg caacccggtc tcggcctacg tgtccttcga gatctacatc       960
     cgcccggcga tcgagaagat gatgggcatc gagaccggcc cgcgcgagac cgtgaccgcg      1020
     acctgcttcg gcgccttcac ctcgccgagc ggcaagcgcc agttcgcgcg cgggatctac      1080
     gacccgcacg ggctgagcgt ccggccggtc ggcggccacg gctcgcacct ggtcggcgac      1140
     ctggcgctgg cgaacgcgtt gatagtggtg cccgagtacg tgaccgaggt cgtcgacggc      1200
     gacgacgtcg aggtgatcgt gatggagggc ggtccccgat ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page