(data stored in ACNUC7421 zone)

EMBL: CP001700.PE114

CP001700.PE114       Location/Qualifiers
FT   CDS_pept        117588..118124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0114"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: sma:SAV_3671 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69069"
FT                   /db_xref="GOA:C7QHD0"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD0"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACU69069.1"
FT                   /translation="MSSETSGTVETSGVAEAPGGKSDRLTHIDSTGDARMVDVTAKPVS
FT                   ARQARATGFVEVSPKVVELLRGEGMPKGDALSVARIAGIMGAKKTPDLVPLCHPIAISG
FT                   VKVALEVEDSGVAIAATVKTADRTGVEMEALTAVAVAGLTVIDMVKAVDPAAVLTRVQV
FT                   EAKSGGVSGDWSREG"
     atgagctcgg agacctccgg caccgtcgag acctccggcg tcgccgaggc gcccggcggc        60
     aagtccgacc gcctgaccca catcgactcc accggcgacg cgcgcatggt cgacgtcacg       120
     gcgaagccgg tctccgcacg ccaggcgcgg gcgaccggct tcgtggaggt ctcgccgaag       180
     gtggtggagc tgctgcgcgg cgagggcatg cccaagggcg acgccctgtc ggtcgcgcgc       240
     atcgccggga tcatgggcgc gaagaagacc cccgacctgg tcccgctctg ccacccgatc       300
     gccattagcg gagtgaaggt ggcgctggag gtcgaggact ccggcgtcgc catcgccgcg       360
     accgtgaaga ccgcggaccg caccggcgtc gagatggaag cgctgaccgc ggtggcggtc       420
     gccggactca ccgtcatcga catggtcaag gccgtcgacc cggccgcggt gctgacccgg       480
     gtgcaggtcg aggcgaaatc cggcggtgtg tcaggagact ggtcgcgcga ggggtag          537
//

If you have problems or comments...

PBIL Back to PBIL home page