(data stored in ACNUC7421 zone)

EMBL: CP001700.PE115

CP001700.PE115       Location/Qualifiers
FT   CDS_pept        118256..119920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0115"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro10371 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69070"
FT                   /db_xref="GOA:C7QHD1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU69070.1"
FT                   /translation="MTDTSTAAAPPPENDTGRLDGASRARIFSVIVVVVLFAEVAPLQY
FT                   TMVSPAAQLIGRSFPGVGSNIAWMTIIFGLVGGAATPILGKLSDLYGKRNMLLAVGISF
FT                   LIGSLICATTSNWTMFLIGRAFQAVAIAAATVAYGLIRDLIPRKYVPLAIGLVSTGLGV
FT                   SGVGGIMLSGVLTDTAGWSYKALFWFLVIYTLVTLPLLFLVCPETKFRARQKLDPFGAL
FT                   LLAGGVGFALLYVSNGANVGWSDPLYLGYLLLGVVLMAGFVLLERRVSQPIIDLRLLFS
FT                   PKVSVVLFIAFFAAIVVGIQAFSIPYMVSTPSHDGLIAMTQQGAAARFKGLVQPNQIPV
FT                   KVLGDIGYGLGFTLLGLAFHVQVWGSSVSMFSGAASGQLSGKIGARKPLLIGMLTFAAT
FT                   SGIYAAAHHGALTLALVGIVFGVGFGAYYATTPNLLVEASPPEQQGITAGMLGVSNSIG
FT                   TAVGTAIAAAFQAAHPVRLIVAGQTVLAGTPDPKTGVTERAGVFTDTAYTQIFIACAIA
FT                   GFIALAATFFMRSGRTASTGGLGYLTDPAPAKETAPA"
     atgaccgata cgagcacagc ggccgcacct ccgcctgaga acgacacggg gcgcctcgac        60
     ggtgcctccc gtgcgcgcat cttctccgtc atcgtggtcg tcgtgctctt cgccgaggtc       120
     gcgcccttgc agtacacgat ggtctcgccg gcggcgcagc tgatcgggcg cagcttcccc       180
     ggcgtgggca gcaacatcgc gtggatgacg atcatcttcg ggctggtcgg cggggcggcg       240
     acgccgatcc tgggcaagct gtccgacttg tacggcaagc ggaacatgct gctggcggtc       300
     gggatctcct tcttgatcgg gtcgctgatc tgcgccacca ccagcaactg gaccatgttc       360
     ctgatcgggc gggcgttcca ggcggtcgcc atcgcggcgg ccaccgtcgc ctacgggctg       420
     atcagggacc tgatcccgcg caagtacgtg ccgctggcga tcgggctggt gtccaccggg       480
     ctcggggtgt ccggggtcgg cgggatcatg ctctccggcg tgctgacaga caccgccggc       540
     tggagttaca aggcgctgtt ctggttcctg gtgatctaca cgctcgtcac gctgccgctg       600
     ctgttcctgg tgtgcccgga gaccaagttc cgcgcccgcc agaagctgga cccgttcggc       660
     gccctgctgc tggccggcgg cgtcgggttc gcgctgctgt acgtgtccaa cggcgcgaac       720
     gtcgggtggt ccgacccgct ctacctgggc tacctgctcc tcggcgtggt gctcatggcg       780
     gggttcgtcc tcctggaacg gagggtcagc caaccgatca tcgacctgcg gctgctgttc       840
     tcgccgaagg tctcggtggt gctgttcatc gccttcttcg ccgcgatcgt ggtcggcatc       900
     caggcttttt ccattcccta catggtgtcc acgccaagtc acgacggcct catcgcgatg       960
     acccagcagg gcgccgcggc gcgcttcaag ggactggtgc agccgaacca gatcccggtg      1020
     aaggtgctcg gcgacatcgg gtacgggctc gggttcacgt tgttgggcct ggcgttccac      1080
     gtccaggtgt ggggctcgtc ggtgtcgatg ttctccgggg cggcgtccgg gcagttgtca      1140
     ggcaagatcg gcgcacgtaa gccgttgctg atcgggatgc tcacgttcgc cgccaccagc      1200
     ggtatatacg ccgccgcgca tcacggcgca ctgacgctgg cactggtcgg catcgtcttc      1260
     ggtgtcggat tcggcgcgta ctacgcgacg acaccgaacc tgctcgtgga agcctctcca      1320
     ccggagcaac agggaatcac agcgggcatg ctcggagtgt ccaactccat aggcactgct      1380
     gtgggaaccg ctatagcggc ggccttccag gcggcgcacc ctgtgaggct gattgtggcc      1440
     ggacagaccg ttctcgcagg tactcccgat ccgaagaccg gagtaacgga gcgcgcggga      1500
     gtcttcaccg acactgccta tacgcagatc ttcatagcgt gtgcgatagc cggcttcatc      1560
     gcgctggcag ctacgttctt catgcggtct ggacgaacag cttctacagg tggtctcggc      1620
     tacctgaccg acccggcgcc tgcgaaagag accgcgcctg cttaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page