(data stored in ACNUC7421 zone)

EMBL: CP001700.PE116

CP001700.PE116       Location/Qualifiers
FT   CDS_pept        complement(119946..121391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0116"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mxa:MXAN_3480 iron-sulfur cluster-binding protein, Rieske
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69071"
FT                   /db_xref="GOA:C7QHD2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD2"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACU69071.1"
FT                   /translation="MRGPLMSSTGHAGLRVETPDLRLLCDPWVSPGGAFLGSRFPFPDN
FT                   SHLRAVPRLLEAEWVAVSSAQADHMDVEFLSGLDESVRVVIPAYPSSVLHDRLSAAGVK
FT                   NIVEVEGWQRVPLTDRGDWLTVVPEQSPMAHRAAFLVVADGVSVLHCNDARLSLSQTRR
FT                   AMIEVGGPLDLLALDASEERFRAVKRLVRAVKPRLVMPYGGPGCFLDPELMEHNAVVAP
FT                   GELPAETLTLLPGDSVRITPTSYECVRDPHWEGFAYSDSVAVANHLETYAASRAQEIAD
FT                   VWEAYPDPDAGSGLEDRFAEHFVRLGRMSPYFLERIAMTVRFKVAGADGGVWDVHLGTT
FT                   DETAQYTFRVEARWLEAVLGGEIRWEDLLLSRRIHVEHAPEADGSYLFGLLMHADADAL
FT                   QAIEDYDKRDPDSTVTLTSGDRTFEVTRYCPHSGEDLAEGAVIDEAPEGLVLRCLAHNF
FT                   DFSLTTGLCLNARCEPIVVAAPV"
     gtgcgcggtc cactcatgag ttcgacagga cacgccggat tgcgcgtcga gacaccggat        60
     ctgcggctgt tgtgcgatcc gtgggtgtca ccgggcggag cgttcctcgg gtcgcggttt       120
     ccgttcccgg acaatagcca tctgcgcgcg gttcccaggc tgctggaggc cgaatgggtc       180
     gcggtgtcga gcgcgcaggc ggaccacatg gatgtggagt tcctgtccgg gctcgatgag       240
     agcgtccggg tggtcatccc cgcctatccc tcgtctgttc tccatgaccg gttgagcgcg       300
     gccggagtga agaacatcgt cgaggtcgaa ggctggcagc gtgtgccgct caccgatcgc       360
     ggcgactggc tgacggtcgt tcccgagcag tcgccgatgg cgcatcgggc ggcgttcctc       420
     gtcgtcgccg atggggtttc ggtcctgcac tgcaatgacg cccggctgtc tttgtcgcag       480
     acgcggcggg cgatgatcga ggtcggcgga ccgctggatc tgctggcgct ggacgcttcc       540
     gaggagcggt tcagagcggt gaagcggttg gtgcgcgctg tgaagccgcg cttggtgatg       600
     ccgtatggcg gaccgggatg cttcctggat ccggagctta tggagcacaa cgccgttgtc       660
     gcgcctggcg aactccccgc agagacgttg acgctgctcc ctggggacag cgttcgtata       720
     acaccgacga gctatgagtg cgtaagagat ccgcactggg aggggttcgc ttatagcgac       780
     tccgtcgctg ttgcgaatca cctggagacc tacgcagcct cgcgtgcgca ggagatcgcc       840
     gatgtctggg aggcgtatcc cgatcctgat gcgggttcag gactggaaga tcggttcgcg       900
     gagcactttg tgcgccttgg acggatgagt ccgtacttct tggagcggat cgccatgacg       960
     gtccggttca aggtcgcggg tgctgacggc ggggtgtggg acgtacacct cggcaccact      1020
     gatgagactg cgcagtacac gttcagggtg gaagctcggt ggttggaagc tgttctcggt      1080
     ggagagatcc gctgggagga tctactcctg tcgcgacgca tccatgtgga gcacgctccg      1140
     gaagccgacg gctcttactt gttcggtctc cttatgcacg cggacgcgga tgcgttgcag      1200
     gctatagagg actacgacaa acgcgacccg gactccaccg tcaccctgac gtccggcgac      1260
     cggaccttcg aggtgacgcg ctactgtccc cactccggcg aagacctcgc agagggtgcg      1320
     gtgatagacg aggcgccgga aggtcttgtt ctgcgctgct tggcgcacaa ctttgacttc      1380
     tcactcacca ctggactgtg tctgaacgct cggtgcgagc ccatcgtggt ggcggcgcct      1440
     gtctaa                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page