(data stored in ACNUC7421 zone)

EMBL: CP001700.PE117

CP001700.PE117       Location/Qualifiers
FT   CDS_pept        complement(121480..122364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69072"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD3"
FT                   /inference="similar to AA sequence:KEGG:Tfu_0410"
FT                   /protein_id="ACU69072.1"
FT                   /translation="MHVPKLGLRKAAALAAAALCGLAVSAGPASASDGWKHQPYDYYLA
FT                   LGDSLGAGWQPNAVTGQGYISGHGYADDIAASLKLQGGKYVNLACPGETTGSMIHGGCP
FT                   YPEPYKNQLDAAASFLKAHKGDRVLVTLDIGANDVDGCASATGLDIQCGLTGIQQTSQD
FT                   LPVILRTLRAAAGHKTEFVGSTYYNPFLASWLTGSAGQSNAKLSAAFLNLFNAVFAIEY
FT                   PLNGVRVADVSAAFSSNDFVHQVTLQPGVTVPLNVARICQWTWMCAPAPVGPNIHANDA
FT                   GYTVMAKAFEAVI"
     atgcacgttc ccaaactcgg tctgcgcaag gccgccgcgc tcgcggccgc cgcgctgtgc        60
     ggcctggcgg tgagcgccgg cccggcgagc gcgtccgacg gctggaagca ccagccgtac       120
     gactactacc tcgccctcgg cgactcgctc ggcgccggct ggcagccgaa cgcggtgacc       180
     ggccagggct acatcagcgg ccacggctac gccgacgaca tcgccgcctc gctcaagctc       240
     cagggcggca agtacgtgaa cctggcgtgc cccggcgaga ccacgggctc gatgatccac       300
     ggcggctgcc cctacccgga gccgtacaag aaccagctcg acgccgccgc ctcgttcctg       360
     aaggcgcaca agggcgaccg ggtcctggtg accctggaca tcggcgcgaa cgacgtcgac       420
     ggctgcgcca gcgccaccgg cctggacatc cagtgcggcc tgaccgggat ccagcagacc       480
     tcgcaggacc tgccggtgat cctcaggaca ctgcgcgcgg cggcggggca caagacggag       540
     ttcgtcgggt cgacgtacta caacccgttc ctggcctcgt ggctcaccgg gtccgcgggc       600
     cagagcaacg ccaagctgtc cgcggcgttc ctgaacctgt tcaacgcggt gttcgcgatc       660
     gagtacccgc tgaacggggt gcgcgtcgcc gacgtcagcg cggccttctc cagcaacgac       720
     ttcgtccacc aggtgacgct gcagcccggc gtcaccgtgc cgctgaacgt ggcgcgcatc       780
     tgccagtgga cgtggatgtg cgcgccggcg ccggtcgggc ccaacatcca cgcgaacgac       840
     gcgggttaca cggtgatggc gaaggccttc gaagcagtca tctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page