(data stored in ACNUC7421 zone)

EMBL: CP001700.PE118

CP001700.PE118       Location/Qualifiers
FT   CDS_pept        complement(122637..123221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0118"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO3133 MarR family regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69073"
FT                   /db_xref="GOA:C7QHD4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU69073.1"
FT                   /translation="METPHTQGLDAATPADNGAPAPAAPAASDPQACRDEVDRLVEAWR
FT                   HERPDLDVAPLEVLSRVSRLARHLDRARRTAFAEHDLEPWEFDVLSALRRAGAPYQLTP
FT                   SKLLTQTLVTSGTMTNRIDRLAAKDLVKRLPDPGDRRGVLVQLSDTGRERVDGAFEGLL
FT                   AQERELLGGLSAGDRTTLAALLRTLVLPFDN"
     gtggagacgc cacacacaca gggcctggac gccgcgactc ccgccgacaa cggcgccccc        60
     gccccggccg ccccagccgc ctcagacccg caggcctgcc gcgacgaggt ggaccgcctg       120
     gtcgaagcct ggcggcacga gcgccccgac ctggacgtgg cgccgctgga agtcctctcc       180
     cgggtctccc gcctggcccg acacctcgac cgcgcacgcc gcaccgcctt cgccgagcac       240
     gacctggagc cgtgggagtt cgacgtgctc tccgcgctgc gccgcgcagg cgcgccgtat       300
     cagctcactc ccagcaaact gctgacgcag accctggtca ccagcggcac gatgaccaac       360
     cgcatcgacc ggctcgcggc caaggacctg gtcaagcgcc tccccgatcc tggcgaccgg       420
     cgcggggtgc tggtgcagct gtcggacacc ggccgcgagc gcgtggacgg cgccttcgaa       480
     gggctgctgg cgcaggagcg cgagctgctc ggcgggcttt ccgccggcga ccgcacgacg       540
     ctcgccgcgc tgctgcggac cctggtcctg cccttcgaca actga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page