(data stored in ACNUC7421 zone)

EMBL: CP001700.PE119

CP001700.PE119       Location/Qualifiers
FT   CDS_pept        123390..124196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0119"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sco:SCO3132 trans-aconitate
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69074"
FT                   /db_xref="GOA:C7QHD5"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD5"
FT                   /inference="protein motif:PRIAM:2.1.1.144"
FT                   /protein_id="ACU69074.1"
FT                   /translation="MADDIWNAQQYLRFENDRLRPFLDLVTQLDADGDVHTVVDLGCGP
FT                   GNGTALLVDWWPGARIVGVDSSPAMIEAAQEQAIPGQVEFELGDLRQWRADGKVDVLLA
FT                   NAVLQWVPDHLDLLPDLAAQLAPGGVLGFQVPGNFEAPSHLALAEMKRRWAGRVPDDLQ
FT                   KPASHDPAVYLEKLAESGLEPDVWETTYTYLVPADPDPSVPCGVTEFVRGSALRPAIKA
FT                   LSESDAADFVSEYDTLARAAYPVRELGGHSVQLLPYRRIFAIGRTV"
     atggccgacg acatctggaa cgcccagcag tacctgcggt tcgagaacga ccgcctccgc        60
     cccttcctgg acctggtcac ccagctcgac gcggacggcg acgtgcacac cgtcgtcgac       120
     ctgggctgcg gcccgggcaa cgggaccgcg ctgttggtcg actggtggcc cggcgcccgg       180
     atcgtgggcg tcgactcctc tccggcgatg atcgaggcag ctcaggagca ggcgattccc       240
     ggacaggtcg agttcgagct cggcgacctg cgccagtggc gcgcagacgg caaggtggac       300
     gtcctgctgg ccaacgccgt gctccagtgg gtcccggacc acctggacct gctcccggac       360
     ctggccgcgc agctcgcccc cggcggcgtg ctcggcttcc aggtccccgg caacttcgag       420
     gcgccctcgc acctggccct cgccgagatg aagcgccggt gggccggccg cgtcccggac       480
     gacctgcaga agcccgcgtc ccacgacccg gcggtctacc tggagaagct ggccgagtcc       540
     gggctggagc cggacgtgtg ggagaccacg tacacctacc tggtcccggc tgacccggac       600
     ccgtcggtgc cctgcggcgt gacggagttc gtgcgcggca gtgcgctgcg tccggcgatc       660
     aaggcactga gcgagtccga cgccgccgac ttcgtgtccg aatacgacac cctggcccgc       720
     gccgcctacc cggtccgcga actcggcggg cacagcgtgc agctgctgcc gtaccggcgg       780
     atcttcgcca tcggccggac ggtctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page