(data stored in ACNUC7421 zone)

EMBL: CP001700.PE120

CP001700.PE120       Location/Qualifiers
FT   CDS_pept        124248..124604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0120"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: stp:Strop_4178 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69075"
FT                   /db_xref="GOA:C7QHD6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD6"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACU69075.1"
FT                   /translation="MLAALHHAQVAVPKGAEDVSRAYYVGVLGMTELPKPPVLAARGGC
FT                   WFAAGGLEIHTGVEEPFIPARKAHPAILVTDIDELAAALTAAGHEVAWDQTIPDKRRLH
FT                   TFDPHGNRLEFIQQ"
     atgctcgcag cactgcatca cgcacaggtc gccgttccga agggcgccga ggacgtctca        60
     cgcgcctact atgtcggcgt cctgggcatg accgagctgc ccaagccgcc ggtcctggcc       120
     gcgcgcggcg gctgctggtt cgccgccggc ggcctggaga tccataccgg cgtcgaagag       180
     ccgttcatcc cggcccgcaa ggcgcatccg gcgatcctgg tgactgacat cgacgagctg       240
     gccgccgcgc tcaccgcggc cgggcacgag gtcgcctggg accagaccat cccggacaag       300
     cgccgcctgc ataccttcga cccgcacggc aaccggctgg agttcatcca gcagtag          357
//

If you have problems or comments...

PBIL Back to PBIL home page