(data stored in ACNUC7421 zone)

EMBL: CP001700.PE121

CP001700.PE121       Location/Qualifiers
FT   CDS_pept        complement(124668..125171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0121"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   mab:MAB_1523c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69076"
FT                   /db_xref="GOA:C7QHD7"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD7"
FT                   /inference="protein motif:PFAM:PF06210"
FT                   /protein_id="ACU69076.1"
FT                   /translation="MAREYIPPRLDQPRGRRQVSLKPSFDPDAFGRVSETIARFFGTAR
FT                   YLFIQSLIVVIWIALNILVVTKAIRWDPYPFILLNLAFSTQAAYAAPLILLAQNRQAER
FT                   DKVQIAEDKAREELSFATMEYLTREIASLRMAVGEVATRDYVRGELQSLLKELDERGRD
FT                   YSGE"
     atggcacgcg aatacatccc gccgcggctg gaccagccgc gcggccgccg gcaggtctcg        60
     ctgaagccgt cgttcgaccc ggacgccttc ggccgggtct cggagaccat cgcgcgcttc       120
     ttcggcaccg cgcggtacct gttcatccag tccctgatcg tcgtgatctg gatcgccctg       180
     aacatcctgg tggtcaccaa ggcgatccgc tgggacccct accccttcat cctgctgaac       240
     ctggcgttct ccacgcaggc cgcgtatgcc gcgccgctga tcctgctggc gcagaaccgg       300
     caggccgagc gggacaaggt gcagatcgcc gaggacaagg cccgcgagga gctgtcgttc       360
     gcgacgatgg agtacctgac ccgggagatc gcctcgctgc ggatggcggt cggcgaggtc       420
     gcgacccggg actacgtgcg cggcgaactc cagtccctgc tcaaggaact ggacgagcgc       480
     ggccgggatt actccgggga gtag                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page