(data stored in ACNUC7421 zone)

EMBL: CP001700.PE122

CP001700.PE122       Location/Qualifiers
FT   CDS_pept        complement(125172..126536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0122"
FT                   /product="MgtE intracellular region"
FT                   /note="PFAM: MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: ace:Acel_1818 MgtE intracellular
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69077"
FT                   /db_xref="GOA:C7QHD8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD8"
FT                   /inference="protein motif:PFAM:PF03448"
FT                   /protein_id="ACU69077.1"
FT                   /translation="MRALSRVYVSHLAGRSVFDADGEPVGRIRDIVVSMGAGDAAPRVL
FT                   GLVLEMQMHGRRRVFLPIGRVTSIESNQVVSTGLVNMRHFQQRPGETLVLTELLDRRVT
FT                   LKATGETATVRDVAFEPERAGKEMALTKLFVQKAAKTTGLRRRGESLTVDWDAVEGLEV
FT                   SGAQGAAELVAALDKLHAADLAHVMHELSPRRRGEVAAALDDERLADVMEELPEDDQVE
FT                   ILGELESERAADVLEAMDPDDAADLLGELSADEAERLLALMEPQDANPVRRLLSYREDT
FT                   AGGLMNSDPIILLPNATVAEALALVRDEERTPANASLVFVTRAPTETPTGRYLGAVHIQ
FT                   RLLREPPMALVSAAVDVELEPLAPDTMLNEVTAYMATYNLVAVPVVDADDRLLGAVTVD
FT                   DVLDHLLPDDWRLRPPGSHPHDELPPEAREVVELLEGQDAADGAPSPIRTGPGEG"
     gtgagggccc tgtcccgggt gtacgtctcc cacctcgccg gccggtccgt gttcgacgcg        60
     gacggcgagc cggtgggccg catccgcgac atcgtggtca gcatgggcgc cggcgacgcc       120
     gcgccccggg tgctcggcct ggtcctggag atgcagatgc acggccggcg gcgggtcttc       180
     ctgccgatcg gccgggtcac ctcgatcgag agcaaccagg tggtctccac cggcctggtg       240
     aacatgcggc atttccagca gcggcccggc gagacgctgg tcctcaccga gctgctggac       300
     cgccgggtga cgctgaaggc caccggcgag accgcgaccg tgcgcgacgt cgccttcgag       360
     cccgagcgcg ccggcaagga gatggccctc accaagctgt tcgtccagaa ggcggccaag       420
     accacggggc tccggcggcg cggggagtcg ctgaccgtgg actgggacgc cgtcgagggc       480
     ctggaggtct ccggcgcgca gggcgccgcc gagctggtcg cggcgctgga caagctgcac       540
     gccgccgacc tggcgcacgt catgcacgag ctgtcgcccc ggcggcgcgg ggaggtcgcc       600
     gcggcgctgg acgacgagcg cctcgccgac gtcatggagg agctgcccga ggacgaccag       660
     gtggagatcc tgggcgaact ggagtcggag cgcgccgccg acgtgctgga ggcgatggac       720
     cccgacgacg ccgccgacct gctcggcgag ctgagcgcgg acgaggccga gcggctgctg       780
     gcgctgatgg aaccgcagga cgcgaacccg gtgcggcggc tgctgtccta ccgcgaggac       840
     accgccggcg gtctgatgaa ctccgacccg atcatcctgc tgccgaacgc gaccgtcgcc       900
     gaggcgctgg cgctggtccg ggacgaggag cggacgccgg cgaacgcctc gctggtgttc       960
     gtcacccgcg cgccgacgga gaccccgacc ggccgctacc tgggcgccgt gcacatccag      1020
     cggctgctgc gcgagccgcc gatggcgctg gtgtcggcgg cggtggacgt cgagctggag      1080
     ccgctggcgc cggacacgat gctgaacgag gtcacggcgt acatggcgac ctacaacctg      1140
     gtcgccgtgc cggtggtgga cgccgacgac cggctgctgg gcgccgtcac cgtcgacgac      1200
     gtgctggacc acctgctgcc ggacgactgg cggctgcggc ctccgggcag ccacccgcac      1260
     gacgagctgc cgccggaggc gcgcgaggtc gtggagctgt tggaggggca ggacgccgcg      1320
     gacggggcgc ccagcccaat ccgcaccggg ccgggggagg gatag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page