(data stored in ACNUC7421 zone)

EMBL: CP001700.PE123

CP001700.PE123       Location/Qualifiers
FT   CDS_pept        126813..127631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_3109 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69078"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69078.1"
FT                   /translation="MAIAAVAALAGCGSTGTNGVAKKGAGSIVATAEGAVLNATSVHIQ
FT                   GQFTSGNQPVALDLRLEKDKGASGTVTIGTEVLELLRVGPDVYVKGDEAFYRSVLSRLG
FT                   TASAPAPSAPSAPSTSGSASGSSSKSPSAAGSSSAGTSTTGTPSAGQSSSDNSIAVTAM
FT                   QINYLHIGPTDAQYQTFASLTDPRQLLAQIMQGIGSLGKDGQKDIRGTKSIVLSGSKDT
FT                   RVYVAIDGQPFLERVLPPGGGTLDFMDYNTPVTLNPPPPGQVVDIAKIAK"
     gtggcgatcg cagccgtggc ggcgctggcc ggctgcggct ccaccggcac caacggcgtg        60
     gcgaagaagg gcgccggctc catcgtcgcc accgccgaag gcgccgtgct gaacgccacc       120
     agcgtgcaca tccagggcca gttcacctcc ggcaaccagc ccgtcgccct ggacctgcgc       180
     ctggagaagg acaagggcgc ctccggcacg gtgaccatcg gcaccgaggt cctggagctg       240
     ctgcgcgtcg gaccggacgt ctacgtcaag ggcgacgagg ccttctaccg ctccgtgctg       300
     tcgcggctcg gcacggcctc cgccccggcg cctagcgcgc cgagcgcgcc gtcaacgtcg       360
     gggtcggcct cggggtcgtc ctcgaagtcg ccgtccgccg caggctcttc gagcgcgggc       420
     acgtccacca cgggcacccc gagcgcgggc cagagctcct cggacaacag catcgccgtc       480
     accgcgatgc agatcaacta cctgcacatc ggcccgaccg acgcgcagta ccagaccttc       540
     gcctccctga ccgacccacg ccagctgctc gcgcagatca tgcagggcat cggctccctc       600
     ggcaaagacg gccagaagga catccgcggc accaagtcca tcgtcctgtc cggctccaag       660
     gacacccgcg tatacgtggc catcgacggg cagcccttcc tggaacgcgt actgcccccc       720
     ggcggcggaa ccctggactt catggactac aacaccccgg tgacgctgaa tccgccgccg       780
     ccgggacagg ttgtcgacat agccaagatc gcgaagtag                              819
//

If you have problems or comments...

PBIL Back to PBIL home page