(data stored in ACNUC7421 zone)

EMBL: CP001700.PE124

CP001700.PE124       Location/Qualifiers
FT   CDS_pept        complement(127663..128745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69079"
FT                   /db_xref="GOA:C7QHE0"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69079.1"
FT                   /translation="MTDDELALQRDLDEELNRLQPRPVPTEAVYGRARELRRTRRMWAA
FT                   GVLATAAVVGTSLPILGSMGLRQNAAGGGQAVTVNTPHTDKKGRYVFSGSEEGKRWSTT
FT                   VAPGDCPSSGSFNLNVACNASSGSDPAELSYAAPAGLPTTYAIYFRSDIARIDMTLSDG
FT                   GQATLVPGIVRGNRVALVVIPPKIEITRVDVFAADGSPVGFSIPFQADGMAHLAMWYQP
FT                   GQTPTQPEASGTITGITQKGEHASVGVRIGPFGICYTVAQRSTPGAVPITNCRPFSAAA
FT                   SDDVPPNPPDWVALGGLVDDRVDHVDFALTTGTIRVQTVRIGAYSFAVGFADYSFTSLG
FT                   ETAYDASGHVIDREQTPSKS"
     atgacggacg acgaactggc tctgcagcgt gatctcgacg aggagctgaa ccggctccag        60
     ccccgcccgg tcccgaccga agcggtctac ggccgcgcgc gggagttgcg gcgcacgcgg       120
     cgcatgtggg cggctggagt gctggcgacg gcagcggtgg tggggacgag cctgccgatc       180
     ttgggctcga tggggttgcg gcagaacgcg gccggtggcg ggcaggccgt cacggtgaac       240
     acgcctcaca ccgacaaaaa ggggcggtac gtgttctccg ggagcgagga gggcaagcgc       300
     tggagcacca ccgtcgctcc cggcgactgc ccgtcctcgg gcagcttcaa tttgaatgtg       360
     gcctgcaacg cgtcgtctgg cagcgatccg gcagagctct cctacgcggc accggctggt       420
     ctgccgacga cgtacgcgat ctacttccgc tcggacatcg cgcggatcga catgacgctg       480
     agcgacggcg gacaggcgac gttggtgccg ggaatcgtgc gcgggaatcg ggtcgccttg       540
     gtagtgatac cgccgaagat tgagatcacc cgggtcgacg tcttcgcggc ggacggaagt       600
     ccggtcggat tctctatccc gttccaggct gatggcatgg cgcacctcgc gatgtggtac       660
     caacccggcc agacccccac ccaaccggaa gcctccggga cgatcaccgg catcactcag       720
     aagggtgagc acgcgtcggt cggcgtccgg atcggaccgt tcgggatctg ctacaccgtc       780
     gcgcagcggt ccacgcctgg cgcggtaccc atcacgaatt gccggccgtt cagcgcggcg       840
     gcatccgatg acgtgcctcc caaccctccg gactgggtcg cgctgggcgg gctggtggac       900
     gaccgggtcg accatgtgga cttcgcgctg accaccggca cgatccgcgt tcagaccgtg       960
     cgcatcggcg cctactcctt cgcggtgggc ttcgccgact acagcttcac gtcgctgggc      1020
     gagaccgcct acgacgcctc cggccacgtc atcgaccgcg agcagacgcc gagcaagtcg      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page