(data stored in ACNUC7421 zone)

EMBL: CP001700.PE125

CP001700.PE125       Location/Qualifiers
FT   CDS_pept        complement(128742..129254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0125"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: fre:Franean1_0089
FT                   ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69080"
FT                   /db_xref="GOA:C7QHE1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE1"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69080.1"
FT                   /translation="MRADEDGHDAEFHAFMVGRWPSLVRFAYGLTGDHGHAEDLAQAAL
FT                   AKALVSWSRVRRADDPDAYVRRILINLNRRRFRRRRVEEHVGGEAPEPAAPDSTDQLDQ
FT                   RATLIPALMELPPGQRAVVILRYWDGLTETQTAAILGCSVGNVRSQASRALARLRTNPR
FT                   LHDGSAS"
     atgcgagcgg acgaggacgg ccatgacgcc gagttccacg cattcatggt cggccgctgg        60
     ccgtcgctgg tccggttcgc ctacggcctg accggcgacc acggccacgc cgaggacctg       120
     gcgcaggccg cgctggcgaa ggcgctcgtg tcgtggtccc gggtccgccg cgcggacgat       180
     ccggatgctt atgtccgccg cattctgatc aacctcaacc gccggcggtt ccgcagacgc       240
     cgcgtggagg agcacgtcgg cggcgaggcg ccggaaccgg ccgcccccga cagcacagac       300
     cagctcgacc agcgcgcgac gctgatcccg gcgctgatgg agctgccgcc cggccagcgc       360
     gcggtcgtca tcctgcggta ctgggacggc ctgaccgaga cgcagacggc ggcgattctg       420
     ggctgctcgg tcggcaacgt gcgcagccag gcttcccgcg cgctggctcg cctgcgcacc       480
     aatccgcggc tgcacgatgg gagcgcgtca tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page