(data stored in ACNUC7421 zone)

EMBL: CP001700.PE126

CP001700.PE126       Location/Qualifiers
FT   CDS_pept        complement(129322..130161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0126"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: aau:AAur_0159 type I
FT                   phosphodiesterase / nucleotide pyrophosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69081"
FT                   /db_xref="GOA:C7QHE2"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE2"
FT                   /inference="protein motif:PFAM:PF01663"
FT                   /protein_id="ACU69081.1"
FT                   /translation="MSTSRVLVIGIDGTRLDFLDAEPTPNIDRVAGEGFLATVWVEDGT
FT                   PTVSGPCWATAVTGTTIERHHIGSNDFAGHRLAEHPDFLTVLTRDFGLHTYLAVGAWPP
FT                   LATPADHGPMFAAPSRLTFATFGQSAQACDQGDETITRDAERILATENIHAAFVYLGAN
FT                   DATAHDQGCGDLYRTAIRRTDARTGRLLAAVASRPDRATENWTFILLTDHGHLPEGGHG
FT                   GTTTPERTAWIAACGPGIQAGADYGTLRHVDVAAHVYAALGVEPEIVLDGKAFQTMH"
     atgagcactt cacgcgtttt ggtgatcggc atcgacggca cacgcctgga cttcctggac        60
     gccgagccga ccccgaacat cgaccgggta gcaggcgaag gcttcctcgc cacggtctgg       120
     gtcgaggacg gcaccccgac cgtgtcagga ccctgctggg ccaccgccgt caccggcacc       180
     acgatcgagc gacaccacat cggcagcaac gatttcgccg gccaccgcct cgccgaacac       240
     cccgacttcc tgaccgtact gacccgcgac ttcggcctgc acacctacct cgccgtcggc       300
     gcctggccac ccctggccac ccccgccgac cacggcccga tgttcgccgc accctcccgc       360
     ctgaccttcg ccaccttcgg ccagtcagcc caagcctgcg accaaggcga cgaaaccatc       420
     acccgcgacg ccgaacgcat cctggccacc gagaacatcc acgcggcatt cgtctacctc       480
     ggcgccaacg acgccaccgc ccacgaccaa ggctgcggcg acctctatcg caccgccatc       540
     cgccgcaccg acgcccgcac aggacgcctc ctggcagccg tggcatcccg ccccgaccga       600
     gcaaccgaaa actggacctt catcctcctc accgaccacg gccacctccc cgaaggcggc       660
     cacggcggca ccaccacccc cgaacgcacc gcatggatcg ccgcctgcgg ccccggcatc       720
     caagccggcg ccgactacgg caccctgcgg catgtggacg tcgccgcaca cgtgtacgcg       780
     gcgctgggcg tcgagccgga aatcgtgctg gatggaaagg ctttccagac catgcattga       840
//

If you have problems or comments...

PBIL Back to PBIL home page