(data stored in ACNUC7421 zone)

EMBL: CP001700.PE127

CP001700.PE127       Location/Qualifiers
FT   CDS_pept        complement(130199..131221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0127"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: sma:SAV_2089 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69082"
FT                   /db_xref="GOA:C7QHE3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACU69082.1"
FT                   /translation="MAGRAAALLAMRPDVAQAAFPAALRTRLDAVVEIDHGLVVTDFAE
FT                   PRARWALAGAEVLLTGWGCPPLDAEALDAAPNLRAVIHAAGSVKHHLSPDFWTRGILAS
FT                   SAADANAYPVAQFTLSVILLAGKRMFTMARHYAEGTYKPPSTSQRFGNVGRTVGVVGAS
FT                   RIGRLVLPMLAREGFEVLLADPTLSAAEAAALMPAPWAVELVELDELLRRSDVVTLHAP
FT                   SLPETHHLLDDRRLGLMRDGSVLVNTARGALIDTEALVRCCAAGRIDAFLDVTDPDEPL
FT                   PPGHPLFLLPNVVVTPHLAGAMGSEIALLGAYAVADVERYAAGLPLLGGVHQDDLARIA
FT                   "
     atggccggcc gcgccgccgc gttactcgcc atgcgtccgg acgtcgcgca agctgcgttc        60
     ccggccgcgc tgcgcacccg gctcgacgcc gtcgtcgaga tcgaccacgg gctggtcgtg       120
     accgacttcg ccgagccgcg cgcccggtgg gcactggccg gcgcggaggt cctgctgacc       180
     ggctggggct gtccgccgct ggacgccgag gcgctggacg cggcaccgaa cctgcgcgcg       240
     gtgatccacg ccgccggctc ggtgaaacac cacctgagcc cggacttctg gacgcgcggg       300
     atcctcgcgt cctcggccgc ggacgccaac gcctatccgg tcgcgcagtt cacgctcagc       360
     gtgatcctgt tggccggaaa gcggatgttc acgatggcgc ggcactacgc cgagggcact       420
     tacaagccgc cgtcgacctc gcagcgcttc ggcaacgtcg gccgcacggt cggggtggtc       480
     ggcgcgtcgc gcatcggccg cctggtgctg ccgatgctgg cgcgcgaggg cttcgaggtg       540
     ctgctcgccg atccgacgct gagcgccgcc gaggccgcgg cgctgatgcc cgcgccgtgg       600
     gcggtggagc tcgtcgagct cgacgagctg ctgcgccgca gcgatgtcgt gacgctgcac       660
     gcgccgtcgc tgccggagac ccaccacctg ctcgacgacc ggcgcctggg cctgatgcgc       720
     gacggatcag tactcgtcaa caccgcgcgc ggcgccttga tcgacaccga ggcactggtg       780
     cggtgctgcg ccgccggccg gatcgacgcg ttcctcgacg tcaccgatcc cgacgagccg       840
     ctgccgccgg ggcacccgct gttcctgctg ccgaacgtgg tggtgacacc gcatctggcc       900
     ggagcgatgg gaagcgagat cgccctgctc ggcgcctacg cggtcgccga cgtcgagcgg       960
     tacgccgcgg gacttccgct gctcggcggg gtccatcagg atgacctcgc acggatcgcg      1020
     tag                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page