(data stored in ACNUC7421 zone)

EMBL: CP001700.PE128

CP001700.PE128       Location/Qualifiers
FT   CDS_pept        131505..132464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0128"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_1453 putative
FT                   transmembrane lipoprotein LplB"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69083"
FT                   /db_xref="GOA:C7QHE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU69083.1"
FT                   /translation="MAATAAAAAAPAAAKPRAGTRWARFRRDKVLLLMMLPGVLYFGVF
FT                   QYLAQLGNIIAFKDYVPFVGIKDSAWVGFQQFSTLFADPDFWHAVRNTFELALVQLMFF
FT                   FPVPLALAMFLFSLTRNWVRKLVVSFVYLPHFISWVVVVGLFVQVLGPSGMVNSFLTHD
FT                   SHHVVVNVFRDPAWFKPMMLIELVWKDCGWGTIIFLAALYQVDDSLYEAVSLDGAGWAR
FT                   RTWHVTLPSIRPVLVLLLILRVGDILSVGFDQVMQQRDTFTPAAAEVIDTYVYNHGVGS
FT                   GQFSVAAVAGLLKGVVAMVLVIGANKVAHKLGEQGVYQ"
     atggccgcaa cggccgccgc agccgccgcg ccagccgcgg cgaagccccg cgccggcacc        60
     cgctgggcgc gcttccggcg ggacaaagtc ctgctgctga tgatgcttcc gggcgtgctc       120
     tacttcggcg tcttccagta cctggcgcag ctcgggaaca tcatcgcctt caaggactac       180
     gtgcccttcg tcggcatcaa ggacagcgcc tgggttggct tccagcagtt ctcgaccctg       240
     ttcgccgacc ccgacttctg gcacgcggtc cgcaacacct tcgagctggc cttggtccag       300
     ctgatgttct tcttcccggt gccgctggcg ctggcgatgt tcctgttcag cctgacccgg       360
     aactgggtcc gcaagctggt ggtcagcttc gtctacctgc cgcacttcat ctcgtgggtg       420
     gtcgtggtcg ggctgttcgt gcaggtgctc gggccgtccg ggatggtcaa cagcttcctg       480
     acccacgaca gccaccacgt cgtggtcaac gtcttccggg acccggcgtg gttcaagccg       540
     atgatgctga tcgagctggt ctggaaggac tgcggctggg gcacgatcat cttcctggcc       600
     gcgctctacc aggtcgacga ctcgctctac gaggcggtct cgctcgacgg cgccggctgg       660
     gcccgccgca cctggcacgt cacgctgccc tcgatccgcc cggtcctggt cctgctgctg       720
     atcctgcggg tcggcgacat cctctcggtc ggcttcgacc aggtgatgca gcagcgcgac       780
     accttcacgc cggccgcggc ggaggtgatc gacacctacg tctacaacca cggcgtcggc       840
     agcggccagt tctccgtcgc ggcggtcgcc ggcctgctca agggcgtggt ggcgatggtg       900
     ctggtgatcg gcgccaacaa ggtcgcgcac aagctcggcg aacagggggt ctaccagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page