(data stored in ACNUC7421 zone)

EMBL: CP001700.PE129

CP001700.PE129       Location/Qualifiers
FT   CDS_pept        132461..133360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0129"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_1454 putative
FT                   transmembrane lipoprotein LplC"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69084"
FT                   /db_xref="GOA:C7QHE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU69084.1"
FT                   /translation="MSAESPNLRPAWMGRPKPAVSALKAAAVVVILALIAVPFWLVLAT
FT                   SVSSDAEVNANGGWSLWPDKLDFSAYTNVFQGGTIGHALWVSVLVTALGTAASLASTTF
FT                   LAYALSRPNVVAGKPILLAVLFTFLFPAGMIPSFLVVTDLHLFDHLAALFVPVMINVFN
FT                   LVVMRGFFQGIPEELYEAARLDGAGDLRTLFRIVLPLSKAIIAVVGLYYAVGYWNDYFR
FT                   AMLYTNGGSLNPLSTVLRGFVIAGNNPNAEAGVDITGIAPMKAISALVVIAIVPIAAAF
FT                   PFLQRYFTKGVMTGAVKS"
     gtgagtgccg agagcccgaa cctgcgtccg gcgtggatgg gccggccgaa accggcggtc        60
     agcgcgctca aggcggccgc ggtcgtggtc atcctggccc tgatagctgt gccgttctgg       120
     ctggtgctcg ccacgtcggt gtcctccgac gccgaggtga acgccaacgg cggctggtcg       180
     ctgtggccgg acaagctgga cttctccgcg tacaccaacg tcttccaggg cgggaccatc       240
     ggccacgcgc tgtgggtctc ggtcctggtg accgcgctcg gcacggcggc gagcctggcc       300
     tcgaccacct tcctggccta cgcgctgtcc cggccgaacg tggtggccgg caagccgatc       360
     ctgctggccg tcctgttcac gttcctgttc cccgccggga tgatcccgag cttcctggtg       420
     gtcaccgacc tgcacctgtt cgaccacctc gcggcgctgt tcgtcccggt gatgatcaac       480
     gtcttcaacc tggtcgtcat gcgcggcttc ttccagggca tcccggagga gctgtacgag       540
     gcggcgcggc tcgacggcgc cggggatctc aggaccctgt tccgcatcgt gctgccgctg       600
     tccaaggcga tcatcgcggt ggtcggcctg tactacgccg tcggctactg gaacgactac       660
     ttccgggcga tgctctacac caacggcggc tcgctgaacc cgctgtccac ggtgctgcgc       720
     ggcttcgtca tcgccggcaa caaccccaac gccgaggccg gggtggacat caccggcatc       780
     gccccgatga aggcgatctc ggccctggtg gtcatcgcga tcgtgccgat cgccgccgcc       840
     ttccccttcc tgcagcgcta cttcaccaag ggcgtcatga ccggcgccgt caagagctaa       900
//

If you have problems or comments...

PBIL Back to PBIL home page