(data stored in ACNUC7421 zone)

EMBL: CP001700.PE13

CP001700.PE13        Location/Qualifiers
FT   CDS_pept        16080..16481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68968"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU68968.1"
FT                   /translation="MRRPEDIGAFLAEHSDGRVIGQMPAMFGIAVTPAEAEFQRRLLAA
FT                   GHTGSYLALLGLAATLTFDAGEYFHTGEQNRRDLSEWHGYHRGLQTALACLVMHETGSN
FT                   PRQAALMVAEHTETLIRCRWANRPAKGGG"
     atgaggcgcc cggaggacat cggtgccttc ctcgccgagc acagcgacgg gcgggtgatc        60
     gggcagatgc cggcgatgtt cgggatcgcc gtgaccccgg ccgaggcgga gttccagcgg       120
     cggctgctgg ccgccggcca tacgggcagc tacctggcgc tgctggggct ggcggcgacg       180
     ctgaccttcg acgccgggga gtacttccac accggcgagc agaaccgccg cgacctgagc       240
     gagtggcacg gctatcacag aggcctgcag acggccctgg cctgcctggt gatgcacgag       300
     accggcagca acccgcgcca ggccgcgctg atggtcgccg agcacaccga gacgctgatc       360
     cgctgccggt gggccaaccg gccggccaag gggggtgggt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page