(data stored in ACNUC7421 zone)

EMBL: CP001700.PE130

CP001700.PE130       Location/Qualifiers
FT   CDS_pept        133375..135060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0130"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: aau:AAur_1455 putative lipoprotein precursor LplA"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69085"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE6"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU69085.1"
FT                   /translation="MPFTSTAQQISRRTVLRTTGAAAVAAVAVPALAACGGSKTSSGAA
FT                   QSNVDKKLMAWPTYTPAAGLHPDMPGTAAGVQDTFLRYPSNLIQSVPAKPGDGSKVRAL
FT                   IVTYGTQPKGPDQNQLWKAVNDAVGVDLELTMVTDADWQTKLGAMMAASDLPDIIMLGL
FT                   YQLPNEAQFLQAKCEPLGQYLAGDAGAKAYPNLAAIPPYSWDSVGRVGGDFYGIPIHRP
FT                   RLGNSFFADSDLFQQAGIWNPKPGGLSKAELTAGLMKLNTQGHFALGTNKVASFGYLTH
FT                   SGVHGTPNLWSLANGQFTTAYGTDSMKQSLATMADWYGKGLYDPAALTVSSTQCKTDFQ
FT                   NGTYVTTTDGFGGFGGYATAVNEKWKVDFVRPFDAGTGAKPTPWLTPGYFGYTVLKKTT
FT                   PERAKMLLGVLNFLAAPFGSKEWELINYGLEGVHFNRGADGGPSAPTALGKIENSVNVP
FT                   VKYVMAAPLVNYLAGEPEAAKRCYQAQVDIVPIGVTDPSLGVQSATRNKQWPTLLQQIQ
FT                   DGMNQIITGKAQLSSWDDVIKKWKSSGGDQIAAELGAEYAKTHG"
     atgcccttca ccagcaccgc gcagcagatc tcccgcagga ccgtcctgcg tacgaccgga        60
     gccgccgccg tcgcggccgt cgccgttccg gccctggcgg cttgcggggg gtcgaagacc       120
     tcctccggcg ccgcgcagtc caacgtcgac aagaagctca tggcctggcc gacctacact       180
     ccggcggcgg gtctgcaccc tgatatgcct ggcaccgcgg caggcgtgca ggacacgttc       240
     ctgcgctatc cgtccaacct gatccagtcg gtgcccgcca agcccggcga cgggtcgaag       300
     gtgcgcgcgc tgatcgtcac ctacggtacg cagcccaagg gcccggacca gaaccagctg       360
     tggaaggcgg tcaacgacgc cgtcggcgtg gacctcgagc tgaccatggt cacggacgcc       420
     gactggcaga ccaagctcgg cgccatgatg gccgcctcgg atctgccgga catcatcatg       480
     ctcgggctct accagctgcc gaacgaggcg cagttcctgc aggccaagtg cgagccgctg       540
     gggcagtacc tggccgggga cgcgggcgcg aaggcgtatc cgaacctggc cgcgataccg       600
     ccgtacagct gggattcggt gggacgcgtc ggcggcgact tctatgggat cccgatccac       660
     cggccgcgtc tggggaactc gttcttcgcc gactccgacc tgttccagca ggccgggatc       720
     tggaacccga agccgggcgg gctgtcgaag gcggagctga ccgccgggct gatgaagctg       780
     aacacgcaag ggcacttcgc gctcggtacc aacaaggtcg cctcattcgg ttacctgacg       840
     cactccgggg tgcacggcac gcctaacctg tggtcgctcg ccaacggtca gttcaccacc       900
     gcgtacggca ccgacagcat gaagcagtcg ctggcgacca tggccgattg gtacggcaag       960
     ggactctacg acccggcggc gctgaccgtg tcgagcacgc agtgcaagac cgacttccag      1020
     aacggtactt acgtcaccac caccgacggc ttcggcgggt tcggcggcta cgcgaccgcc      1080
     gtcaacgaga agtggaaggt cgacttcgtc cggcccttcg acgccggtac cggcgccaag      1140
     ccgacgccgt ggctcacccc cggctacttc ggctacacgg tactgaagaa gacgacaccg      1200
     gagcgcgcca agatgctgct cggcgtgctg aacttcctcg ccgcgccgtt cggctccaag      1260
     gagtgggagc tgatcaacta cgggctcgaa ggcgtgcact tcaaccgggg tgcggacggc      1320
     ggtccgtcgg cgccgaccgc gttgggcaag atcgagaact cggtgaacgt gccggtcaag      1380
     tacgtcatgg ccgctccgct ggtgaactac ctcgccggcg agccggaggc agccaagcgc      1440
     tgctatcagg cgcaggtgga catcgtgccc atcggcgtga cagacccgag cctgggcgtc      1500
     cagtcggcga cccggaacaa gcagtggccg acgctcttgc agcagatcca ggacgggatg      1560
     aaccagatca tcaccgggaa ggcgcagctc tcgtcctggg acgacgtcat caagaagtgg      1620
     aagagcagcg gcggggacca gatcgccgcc gaactcggcg ccgagtacgc caagactcac      1680
     ggttga                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page