(data stored in ACNUC7421 zone)

EMBL: CP001700.PE131

CP001700.PE131       Location/Qualifiers
FT   CDS_pept        135108..136808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_5337 heparinase II/III family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69086"
FT                   /db_xref="GOA:C7QHE7"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69086.1"
FT                   /translation="MSYLAALEDEVRDVVARAAGSAAPELTYTLYRQFGDTGHRFSYEH
FT                   PYFERRGRLVAAGAAAIFDLRTDSAVSPEVLAVLADELWRICDEHTWALPAHEQYARDG
FT                   DMRRNVDLFAAETAHTVADLIERFGKQLPEDVIMRCREELLDRVFIPFADDQRPMAFEK
FT                   MTNNWLAVVAGGVGMAALAFFPDDAKRLAMILKRAQKSLRRFIEYYPADGGCSEGMDYW
FT                   VYGFGYFAYFAEAWRERGGPDLLLDTKIREIAAFPARVGFGDGRFPSFSDGSETATIPT
FT                   GLMARLVERLGVPVPRIETVPTFASDFCHRWPHLSKNIEWTTERVLNRAASPGVSYLPD
FT                   LAWVVDCGGEAEFAAKGGHNDEFHNHLDVGQFILRAHSETFLADLGAGEYTADYFGTKR
FT                   YQHVHTAAEGHSLPVIDGRGQLPGAQHAAKVERFAETGQGAILTLDMTSAYEVPGLLAL
FT                   GRRFTWQRHGSLVVVDRVETDRPMPFEELYISRIRPVLEADRVVWEGEAARCVLTWQET
FT                   LAMTPELETIETTGHRGELESVFRVRLRCMIEAGASRLESVFTVERKER"
     atgagctacc tggccgccct ggaagacgag gtccgcgacg tcgtggcgag ggcggccgga        60
     tccgccgcgc ccgagctgac ctacacgctg tatcggcagt tcggcgacac cggacaccgt       120
     ttcagctacg agcatcccta tttcgagcgg cgcgggcggc tggtcgcagc cggtgcggcc       180
     gcgatcttcg acctgcggac agacagcgcc gtgagcccgg aggtgctcgc cgttctcgcc       240
     gacgagctgt ggcgaatctg cgacgagcac acctgggccc tgcccgcgca cgagcagtac       300
     gcgcgggacg gggacatgcg gcgcaacgtc gacctgttcg cggccgagac cgcgcacacc       360
     gtcgccgact tgatcgagcg cttcggcaag cagctgcccg aagacgtgat catgcgctgc       420
     cgcgaggagt tgctggaccg ggtcttcatc ccgttcgccg atgaccagcg gccgatggcg       480
     ttcgagaaga tgaccaacaa ctggctcgcc gtggtcgccg gcggcgtcgg aatggcagcg       540
     ctggccttct tccccgacga tgccaagcga ctggcgatga tcctcaagcg cgcgcagaag       600
     tctttgcgcc gcttcattga gtactacccc gccgacggcg gttgctcgga gggcatggac       660
     tactgggtct acggcttcgg gtacttcgcc tacttcgccg aggcctggag ggagcgaggc       720
     ggcccggatc tgttgctgga caccaaaatc cgcgagatcg ccgccttccc agcccgagtc       780
     ggattcggcg acggacgctt ccccagcttc tccgacggtt cggagaccgc gacgatcccg       840
     accggattga tggcgcggct cgtcgagcgg ctcggcgtgc cggtgccgcg catcgagacg       900
     gttccgacct ttgcgtcaga cttctgccat cgctggccgc acctctccaa gaacatcgag       960
     tggacgacgg agcgcgtgct gaatcgcgcg gccagcccgg gtgtttcgta cctgccggat      1020
     ctggcgtggg tcgtcgattg cggcggcgag gcggagttcg cggccaaggg cgggcacaac      1080
     gacgagttcc acaaccatct ggacgtcggc cagttcatct tgcgtgcgca cagcgagacg      1140
     ttcctcgccg atctcggtgc gggcgaatac accgccgact acttcgggac caagcggtat      1200
     cagcacgttc ataccgcagc cgaggggcac tcgctcccgg tgatcgacgg ccgcgggcag      1260
     ttgccgggcg cccagcacgc cgcgaaggtc gagcggttcg ccgagaccgg gcagggcgcg      1320
     atcctcacac tggacatgac ctcggcctac gaggtccccg ggctgctcgc tctcggacgc      1380
     cgcttcacct ggcagcggca cggcagcctg gtcgtcgtgg accgggtcga gaccgaccgt      1440
     ccgatgccct tcgaagagct ctacatcagc cggatccgac ccgtgctcga ggccgatcgc      1500
     gtggtgtggg aaggcgaagc ggcgcgctgt gtacttacct ggcaggaaac cctggcgatg      1560
     accccggaac tggagaccat cgagacgacc ggtcaccgcg gggagctgga aagcgttttc      1620
     cgagttcggc tacgatgcat gatcgaggct ggtgccagcc ggctggagtc cgtgttcacc      1680
     gtcgagcgca aggagcgttg a                                                1701
//

If you have problems or comments...

PBIL Back to PBIL home page