(data stored in ACNUC7421 zone)

EMBL: CP001700.PE132

CP001700.PE132       Location/Qualifiers
FT   CDS_pept        136808..138706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69087"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE8"
FT                   /inference="similar to AA sequence:KEGG:SAV_2106"
FT                   /protein_id="ACU69087.1"
FT                   /translation="MAGALDVPEDRRASPYTGWTREHWLAQADHLLDSVKPFASPSSAR
FT                   FELPGRPSVSGFDSDALEGFARTFLLAAWRIVADQGRGPVAEDLIARYSSGLAAGADAA
FT                   HPEAWPRIPQGRPGQPMVEAASIALGLHYTREWLWDKLDTRAQGLVADWLGEFVGNPTW
FT                   PNNWMLFQTVTEEFLSSIGAEYEESEILRGLDATEEWYVGDGWYTDGAGRNFDYYIGWA
FT                   MHLYPLVWTQMAEGGARNDRALAAREVYRDRLRQFLERYFDFFGADGAPIHQGRSLTYR
FT                   FAAAAPIWVGEMFDCSPYGAGLSRRAASGVMKHFAEHGAPDERGLLTLGWHEPFLPMVQ
FT                   NYSGPASPYWASKGFIGLMLPADHRVWTAPESPLPVEVADFETAIGPVGWSLSGTKRDG
FT                   VVRLLNHGSDKARHHTTPLAEYTDAFYSPLAFSTVTAPDTEAEAWAKRVGNHVALIAPD
FT                   GRVTSRAVIEPIGAAAEWGASRHVPGFEEEPGGTVRGVEGAEIETQTFVKEGAEIRVHR
FT                   VTAPAGWTVREGGYPVAGPEQVLRGENEKLPGAFAINDLGVMSRIESLGGWTSAGVESE
FT                   LGANALGAFSGTPYLMAEHPGGTVFYRSKVMVYRLPDEGVDEGADESVDEGGEVAE"
     atggccggcg cgttggatgt ccccgaggac cggcgggctt cgccgtacac cggctggacg        60
     cgcgagcact ggctcgcgca ggccgatcac ctgctcgatt cggtgaaacc gttcgcctcc       120
     cccagttccg cgcgcttcga gctgccgggg cgtcccagcg tctcgggttt cgactcggac       180
     gccttggagg gcttcgcgcg caccttcctg ctcgcggcgt ggcggatcgt cgccgaccag       240
     ggtcggggac cggtcgccga ggatctgatc gcgcggtact cgtcggggct ggccgccggt       300
     gcggacgccg cgcatcccga ggcctggcca cggattccgc agggacggcc ggggcagccg       360
     atggtggagg cggcgtcgat cgcgctgggt ctgcactaca cgcgcgaatg gctgtgggac       420
     aagctggaca cgcgcgctca agggcttgtc gccgactggc tcggcgagtt cgtcggcaat       480
     ccgacgtggc cgaacaactg gatgctgttc cagacggtca ccgaggagtt cctgtcgtcg       540
     atcggcgccg aatatgagga gtctgagatc ctgcggggtc tggacgccac cgaggagtgg       600
     tacgtcggcg acggctggta caccgacggc gccgggcgca actttgacta ctacatcggc       660
     tgggcgatgc acctgtatcc gctggtgtgg acgcagatgg ccgagggtgg ggcgcgcaat       720
     gaccgcgcac tcgcggcgcg cgaggtgtac cgggaccggc tgcggcagtt cctggagcgc       780
     tacttcgact tcttcggcgc cgacggcgcg ccgatccacc agggtcggtc gctgacctac       840
     cgattcgcgg cggccgcgcc gatctgggtc ggggagatgt tcgactgttc cccttacggc       900
     gcagggcttt cgcggcgtgc ggccagcggc gtgatgaagc acttcgccga gcacggcgcc       960
     cccgatgagc gcgggttgct gacgctggga tggcatgagc cgttcctgcc gatggtgcag      1020
     aactattcgg gccctgcttc gccgtactgg gcgtcgaagg ggttcatcgg actgatgctt      1080
     ccggctgacc acagggtgtg gacggcgccg gagtcgccgc tgccggtgga ggtcgcggac      1140
     ttcgagaccg cgatcggccc ggtcggctgg tcgctgagcg ggacgaagcg cgacggcgtg      1200
     gtccggctgc tgaaccacgg cagcgacaag gcacgccacc acacgacgcc gctcgccgag      1260
     tacaccgacg ccttctactc gccgctggcg ttctcgacgg tgaccgcgcc ggacaccgaa      1320
     gccgaggcgt gggccaagcg cgtcggcaac cacgtcgcgc tgatcgcgcc ggacggccgg      1380
     gttacctcgc gcgccgtgat cgagccgatc ggggcggcag ccgagtgggg cgcgtcgcgg      1440
     cacgtcccgg gcttcgagga ggagccgggc ggtacggtcc gcggggtcga gggcgcggag      1500
     atcgagactc agacctttgt caaagaaggc gccgagatcc gggtccaccg cgtgacggcg      1560
     cctgccggct ggaccgtgcg cgagggcggt tatcccgtcg ccggtcctga gcaggtgctg      1620
     cgtggtgaga acgagaagct gcccggtgcg ttcgcgatca acgacctcgg ggtgatgtct      1680
     cggatcgaga gccttggcgg ttggacgtcg gccggtgtcg agagcgagtt gggcgccaac      1740
     gcgctgggag cgttctcggg gacgccgtat ctgatggcag agcatcctgg cgggacggtg      1800
     ttctaccggt cgaaggtcat ggtgtatcgg ctccctgatg aaggcgtcga tgaaggtgcc      1860
     gatgagagtg tcgacgaggg aggcgaagtc gccgaatga                             1899
//

If you have problems or comments...

PBIL Back to PBIL home page