(data stored in ACNUC7421 zone)

EMBL: CP001700.PE133

CP001700.PE133       Location/Qualifiers
FT   CDS_pept        138703..139476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0133"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sma:SAV_5310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69088"
FT                   /db_xref="GOA:C7QHE9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHE9"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACU69088.1"
FT                   /translation="MSWPLAFSTLGCSGLPLADVVELARSTGWLGLELRAADDEPVHVG
FT                   LSPEERVAARALLESGGVTVLAVASYVKVARGEIGDDECVADALAHADLARDLGAPFVR
FT                   VFPGAEEPGADADARAVRRLNAIAERLPEGVAVLLETHDSHPQGVDIARVLSQVSGDVG
FT                   TIWDVMHPWRTGEPISVTKDVLAPYLRHVQVKDVLSPTERTPLPLGDGTIPLAEFYAAL
FT                   RELGYQGWMSLEWESKWHPEAVPLADALKVKPDFA"
     atgagctggc cgctggcgtt ttcgacgttg ggctgttccg ggttgccgtt ggcggacgtc        60
     gtggagttgg cgcggtccac cggctggctc gggttggagt tgcgggcagc tgatgacgag       120
     cctgtgcacg tcgggctgtc gccggaggag cgggtagctg cgcgggcatt gctggagtcc       180
     ggcggcgtca cggtgttggc ggtcgcgtcg tatgtcaaag tggctcgcgg ggagatcggc       240
     gacgacgagt gcgtcgcgga cgctttggca catgccgatc tcgcacggga tctcggggca       300
     cctttcgtgc gcgttttccc tggtgcggag gagcctggtg ccgacgcgga cgcgcgtgcg       360
     gtgcgtcggc tgaacgcgat cgcggagcgg ttgcccgagg gcgtcgcagt cctcttggaa       420
     actcacgaca gtcatccaca gggtgtggat atcgctcggg tactgtctca ggtctctggt       480
     gatgtcggga cgatctggga tgtcatgcat ccgtggcgga ccggcgagcc gatctccgtc       540
     acgaaggacg tgctggcgcc gtatttgcgg catgtgcagg tgaaggacgt gctctcgccg       600
     accgagcgga cgccgttgcc gctcggcgac ggcacgattc cgctggctga gttctacgcc       660
     gcgttgcgcg agttgggata tcagggctgg atgtcgctgg agtgggagtc gaagtggcat       720
     cccgaggctg tgcctctggc tgacgctttg aaggtgaagc cagacttcgc ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page