(data stored in ACNUC7421 zone)

EMBL: CP001700.PE134

CP001700.PE134       Location/Qualifiers
FT   CDS_pept        complement(139484..140566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0134"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: rsa:RSal33209_0109 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69089"
FT                   /db_xref="GOA:C7QHF0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU69089.1"
FT                   /translation="MPRRPEADRDSTTPRAATIRDVASRAGVSVATVSRVLTGNYPVAS
FT                   ATRTKVLRAVRELDYVVNAHARALAGNRSKMIAVLLSNLTSPFYNRVASGVEQQAMAED
FT                   RLCMVSTTGGDPEREVKLVETLREQNVDAVVLVGGVVDSPEYRDHMARLARLLDSAGSR
FT                   LVICGRPSPGENLPVTVVEYDNAGGAFAATSHLLSQGHRRILFIGGDEANTTTRDRLDG
FT                   YRRAIQAYGIEADPALVIVGNQLPPFAYAELKKRLAAGPPDFTAVFAWDDHIAARTLVA
FT                   LRESGVSVPDQVSVIGYNDEQEAQDLYPALTTVSIPHMELGREAVRLALHRDEAAAPNQ
FT                   HVVLGTHIVMRDSVRPLINR"
     gtgccgagac gacctgaagc cgaccgcgac tcgaccaccc cccgcgcggc gacgatccgc        60
     gacgtggcga gccgagccgg ggtctccgtc gcgaccgtgt cccgggtcct caccggcaac       120
     tacccggtcg cgtccgccac ccgcaccaaa gtcctgcgcg ccgtccgcga gctggactac       180
     gtcgtcaacg cccacgcccg cgccctggcc ggcaaccgct ccaagatgat cgcggtcctg       240
     ctgtccaacc tgacctcgcc cttctacaac cgcgtcgcct ccggcgtgga gcagcaggcg       300
     atggccgagg accggctctg catggtgagc accaccggtg gcgacccgga gcgcgaggtg       360
     aagctcgtcg agacgctgcg cgagcagaac gtcgacgcgg tcgtcctggt cggcggcgtc       420
     gtcgactccc ccgaataccg cgaccacatg gcgcgcctgg cccgcctgct ggacagcgcc       480
     ggctcgcgcc tcgtgatctg cgggcgcccc tcacccggcg aaaacctgcc ggtcacggtc       540
     gtggagtacg acaacgccgg cggcgcgttc gccgcgacca gccacctgct gtcccaaggg       600
     catcgcagga tcctgttcat cggcggcgac gaggccaaca ccaccacccg cgaccgcctc       660
     gacggatacc gccgcgccat ccaggcctac gggatcgagg cggacccggc cctggtcatc       720
     gtcggcaacc agctcccgcc gttcgcctac gccgaactca agaagcggct ggccgccgga       780
     ccgccggact tcaccgcggt gttcgcctgg gacgaccaca tcgccgcccg caccctcgtc       840
     gcactgcgcg agtccggcgt ctccgtcccg gaccaggtat cagtgatcgg atacaacgac       900
     gaacaagaag cgcaggacct ctatccagcg ctgaccaccg tctcgatccc gcacatggaa       960
     ctcggccgcg aagccgtccg cctcgccctg caccgcgacg aagccgccgc cccgaatcag      1020
     cacgtcgtgc tgggcaccca tatcgtgatg cgggattcgg tgcgaccgct catcaaccgg      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page