(data stored in ACNUC7421 zone)

EMBL: CP001700.PE135

CP001700.PE135       Location/Qualifiers
FT   CDS_pept        complement(140607..143765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0135"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: sco:SCO6193 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69090"
FT                   /db_xref="GOA:C7QHF1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF1"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACU69090.1"
FT                   /translation="MIGHGELVADLTARAADAVPTVLTAPPGRGKSALLDAVAEPWIAR
FT                   EDHVVWLTAAPTDRDVPFAALTDLLTEAPDLPEPWLAALKQALRRIPGTPDRVAIRLAA
FT                   RACLDAAIPPDKGVLLLADDLQWWDADSLDVLAHLARHGIPVVAATRPGGPVDLLGRDA
FT                   QEVPVPALTAEQTATLLQERGIGFRIAARVHTAAGGNARLTVEIARGFDATSGALDAVT
FT                   TPAAARRCIRGWIDELPTPDNVWRTLLIAAIAADPAIPTLRRTAGPATLEALACAEQAG
FT                   LITVDVHGTVTFPATAVRDTVLADASQETLRTAHLLLAETTTDPTARLWHRATAARDRP
FT                   DLEVASELAIAARAVRRRGDPGRAAELWLLAAEMMPARETMAETTDASNGSLAPLPAPV
FT                   SGTADRTQHADQQPVARDASAARQHATHAQPSSGPTATTGSLSAPDASTTRHQAATAQP
FT                   ADTPPQTADFPTRATRQPAATSQPISDPTPATSFFTALDASDTRQPAASSAPAGRPSTT
FT                   AASTDQPPRPPASRTTPRPTAVAALLLAAATDAAAAGRPHLARTAVARLDRTESDHAAR
FT                   ARARLAVVDAAGQAVGGLDGILGRALADAEAAADPALLSAVHLRVAWHAHLALGDNRRA
FT                   HDAARAAVRAAELSQDAESRAAALVMLARIEQLLGESSYPRVLRRALALSPEPPGALLN
FT                   SPRWLSVRFALFADQLDEARHHLSQLTSHAERSGSHADRALLLRGAVEIDARAGHGAAA
FT                   IRSARRLEELPGADRASPGPVWFTAALAQTAGGTLEEALRLADRGTAASAQEQDQIFLT
FT                   RCLALSGGIRLLLRDTAAAADDLNRVRTLVAEQGIADPAAVRFHADLAEVLVSLGQPDE
FT                   AAVIVTETRRAAEELRRRGVLASLDRADAVIKASQGDHARAEALLHRADHTFHTLGLPL
FT                   ERGRVLLTRAIIDKRRRRAASARRFHDQATAIFQRAQAPLWEPAEVVTETPGPAHGPGQ
FT                   GPAPDLTAAEQRIVALVTEGLPNREIAANLFLSVKTVESVLTGVYRKLGVRSRTQLAVL
FT                   LRDD"
     atgatcgggc atggggagct cgtcgccgac ctcaccgcgc gcgcggccga cgccgtcccc        60
     accgtcctga cggcaccacc cggccgcggc aagtccgccc tcctcgacgc cgtggcagaa       120
     ccctggatcg cccgcgagga ccacgtcgtc tggctgaccg cggctcccac cgaccgcgac       180
     gtccccttcg ccgccctcac cgacctcctc accgaggcac ccgacctccc cgaaccttgg       240
     ctcgcggccc tcaagcaagc cctccgccgg atacccggca cccccgatcg cgtagcgatc       300
     cgcctcgccg cacgcgcatg cctggacgcg gcaataccgc ccgacaaagg cgtcctgctc       360
     ctggccgacg acctccaatg gtgggacgcg gacagcctcg acgtcctggc ccacctcgcc       420
     cggcacggca tcccggtcgt cgcggcaacc cgccccggcg gcccggtgga cttattgggc       480
     cgcgacgccc aagaagtccc agtccccgca ctgaccgccg aacagaccgc gacgctgtta       540
     caggaacgcg gaatcggctt ccgcatcgcg gcacgcgttc acaccgcagc cggcggaaac       600
     gcccggctga ccgtggaaat cgcccgcggc ttcgacgcca cctccggcgc actcgacgcg       660
     gtcacgacac cggcggcggc acgacgctgc atccgaggct ggatcgacga actgccgacc       720
     ccggacaacg tctggcgcac cctgctgatc gccgcgatcg ccgccgaccc cgcaatcccc       780
     accctgcggc gaaccgcggg cccagccaca ctcgaagccc tagcctgcgc cgaacaagcc       840
     ggactgatca cagtcgacgt gcacggcaca gtcaccttcc cagccacagc agtccgcgac       900
     acagtcctcg ccgacgcatc ccaggaaacc ctccgcacag cccacctcct cctcgccgaa       960
     accaccacgg accccaccgc ccgcctctgg caccgcgcca ccgccgcccg cgaccgccca      1020
     gacctggaag tcgcctccga actggccatc gccgcccgag cagtacgccg acgaggcgac      1080
     ccaggacgcg cggcagagtt atggctgctc gcggcggaga tgatgccggc acgcgaaacc      1140
     atggccgaaa ccacggacgc ctcgaacggc tcgctcgcgc cgctgccggc tccggtgagc      1200
     gggacagccg accggacgca gcacgccgat cagcagccag tcgcgcgcga tgccagcgcc      1260
     gcgcgccagc acgccacaca cgcgcagccg agtagcggcc cgaccgccac cacaggttcc      1320
     ctcagcgcgc ccgatgccag cacaactcgc caccaagccg cgaccgcgca gcccgccgac      1380
     acaccgccac aaaccgcaga cttccccacc agagccactc gccagccagc tgcgacctcg      1440
     cagccgatca gcgacccgac accggccacc agcttcttca ccgctctcga tgccagcgac      1500
     actcgccagc cagccgcgtc ctccgcacca gccggcagac catcgaccac cgcagcctcc      1560
     accgaccaac cgccccgacc tcctgcatcg cgcaccaccc cccgccccac cgccgttgcc      1620
     gccctcctcc tcgccgccgc caccgacgcg gctgctgcgg gccgtccgca cctggcgcgt      1680
     accgcggtgg cgcggctgga tcgcaccgag tccgatcatg cggcgcgggc tcgggctcgg      1740
     ttggcggtgg ttgatgcggc ggggcaggcg gtgggggggt tggatgggat tctggggcgg      1800
     gcgttggctg atgctgaggc ggcggctgat ccggctttgc tctccgccgt gcatctgcgg      1860
     gtcgcgtggc atgcgcatct cgcgctcggc gataatcggc gggcgcatga cgccgcgcgg      1920
     gctgcggtgc gggctgccga gttgtcgcag gatgctgagt cgcgggctgc cgcgctggtc      1980
     atgctggcgc gcatcgagca gttgctcggc gagtcctcgt atccgcgtgt gctgcggcgg      2040
     gcgttggcgc tcagtcctga gcctcctggc gcgctgctga actccccgcg ctggctgagt      2100
     gtgcgcttcg cgctgttcgc cgatcagctc gacgaagcgc gccaccatct cagccagctc      2160
     acctcccacg ccgagcgcag cggcagccac gctgatcgcg cgctcctgct gcgcggcgcg      2220
     gtggagatcg acgcacgcgc cggccacggc gccgccgcca tccgcagcgc acgccgcctc      2280
     gaagaactcc ccggcgccga ccgcgcctcg cccgggcccg tgtggttcac cgccgcgttg      2340
     gcgcagacgg ccggcggcac gctggaggag gcgctgcgcc tcgccgatcg ggggaccgcc      2400
     gcctcggcgc aggaacagga ccagatcttc ctgacccgct gcctcgccct gtccggcgga      2460
     atccggctcc tcctgcgcga caccgcagcg gccgccgacg acctgaaccg tgtcaggacc      2520
     ctggtagcgg agcagggcat cgccgatccg gccgccgtcc gcttccacgc cgacctcgcc      2580
     gaggtcctgg tctcgctcgg ccagcccgac gaggcagccg tgatcgtcac cgagacccgg      2640
     cgcgccgccg aggagctccg acgccgcggc gtcctggcct cgctcgaccg agccgacgcc      2700
     gtcatcaagg cctcgcaagg cgatcacgcc cgcgccgaag ccctcctgca ccgcgccgac      2760
     cacaccttcc acacgctcgg cctccccctg gaacgcggcc gcgtcctgct cacccgcgcg      2820
     atcatcgaca agcgccggcg ccgcgcggca tccgcacgcc gcttccacga ccaagccaca      2880
     gcgatcttcc agcgcgcgca ggcgccgctc tgggaaccgg ccgaagtcgt caccgaaacg      2940
     ccgggaccgg cgcacggccc agggcaggga cccgcgccag acctcaccgc cgccgaacag      3000
     cgcatcgtcg ccctcgtcac cgaaggcctg ccgaaccgcg agatcgccgc gaacctcttc      3060
     ctgtccgtca agaccgtcga aagcgtgctg accggcgttt accgaaagct cggcgtccga      3120
     tcgcgcacgc agctcgccgt cctcttgcgc gatgattag                             3159
//

If you have problems or comments...

PBIL Back to PBIL home page