(data stored in ACNUC7421 zone)

EMBL: CP001700.PE136

CP001700.PE136       Location/Qualifiers
FT   CDS_pept        144022..145890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0136"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; KEGG: sma:SAV_5630 neutral
FT                   zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69091"
FT                   /db_xref="GOA:C7QHF2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF2"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACU69091.1"
FT                   /translation="MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCK
FT                   HAPHSHKHGVQPTETQTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFY
FT                   GSQWGTQTAGSNGVSSFSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGA
FT                   TSCPSNAAFVPYQSGGVLAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRN
FT                   AYYVILSPTGTNPDDYENPSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAG
FT                   QTCGTNFVNSGSAGTLDGYTMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAW
FT                   LKPGTTGGAANVTLGSDTFAEQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTV
FT                   GSAVSLQIQASDSTSGQTLSYTATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTT
FT                   GASGSATFGWTVNSTTGGGTVITNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGN
FT                   LNPSSTSTIAQTFTAGAGNSRLAFWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTC
FT                   TNPTSGWKQVTAAVTAGDSYTLTLSNHDDNYAGDPTYTLYDDVAVS"
     atgaagaaca cgaacacgcg gcggcgggct gccgcggccg gagcggctgt cgccaccatg        60
     gcggccggct tcggactcct ggcggccacc gcgcagaccg cgcaggcctg ggagatcaac       120
     cccgcgtcct gcaagcacgc cccgcacagc cacaagcacg gtgtgcagcc tacggaaacg       180
     cagacgctct gcgaccgtat aaacgccgcc ggacatgcgg ctccgaccgg ctccgagacg       240
     ctgtcctacg gcggcggcgt cgacggcatc ggtgtgaatt ccggtaaaaa tcaggtctat       300
     ctggtgttct acgggtccca gtggggcacg cagaccgccg gctccaacgg cgtctccagc       360
     ttctccggcg acccgaaggg cgccgcgccg gccgcccaga agatgttcaa ggacatcggc       420
     accggcggtg agacctggtc ggccgacctg acccagtggt gcgacggccc gaacgtcgcc       480
     gccggcgcga ccagctgccc gagcaacgcc gccttcgtcc cctaccagag cgggggtgtg       540
     ctggccggtg tctggtacga caactcggcg gcgtccccgg cgaaggccag cggccacgcc       600
     ctcggcgtgg aggcggtgaa cgcggcggcg cacttcggca acacgaccgc cgcctcgaac       660
     cgcaacgcgt actacgtgat cctgtcgccg accggcacga acccggacga ctacgagaac       720
     ccctcgaccg gctactgcgc ctggcacgac tacaacggcg acaccacgct caccggcggc       780
     gccgtcgcca gcagctacgg cgacatcgcc ttcagcaacc agccctacaa catcgacgcc       840
     ggccagacct gcggcacgaa cttcgtcaac tccggcagcg ccggaaccct cgacggctac       900
     acgatgaccc tcggccacga gtggcacgag atgatgtcgg acaagaaccc ggccggcggc       960
     tggaccaaca acaccggctc gtcctacaac ggccaggaga actccgacga gtgcgcgtgg      1020
     ctcaagccgg gcacgaccgg cggcgcggcg aacgtcacgc tgggctcgga caccttcgca      1080
     gagcaggcga gctggtcgaa cgacaccaac ggctgcgcga tgtcgcacca gatcctgacc      1140
     cacaacggcg gcggcgcggt caccgtcacg cagcccgcgg cgcagacctc cacggtcggt      1200
     agcgcggtct cgctgcagat ccaggcgtcg gactcgacgt ccggtcagac cctctcctac      1260
     acggccaccg gcctcccgca gggcgttgcc attaacagtg ccagcggcct gatctccggc      1320
     actccgacca ctgcgggcag ctcgtcagtg accgtgaccg ttaaggacac caccggtgct      1380
     tcgggctcgg cgaccttcgg ctggacggtg aactcgacca ccggcggcgg caccgtgatc      1440
     accaacggcg gcttcgagaa cggctcgctg tccggctgga ccacctccgg cgtcaccgcc      1500
     gcgaccgcca ccggcccgca cgccggcggc tacgcggccg aactcggcaa cctcaacccg      1560
     agcagcacct cgaccatcgc gcagaccttc accgcgggcg cgggtaacag caggctcgcg      1620
     ttctggtaca acgtgacctg cgacgacacg gtgcagtacg actgggcgac ggccacgctg      1680
     aaggacaaca ccaccgggac gaccaagacc gtcctggcca agacctgcac caacccgacc      1740
     tcgggctgga agcaggtgac cgccgcggtc accgcgggcg acagctacac gctgacgctg      1800
     tcgaaccacg acgacaacta cgcgggcgac ccgacgtaca cgctgtacga cgacgtcgcc      1860
     gtgtcgtag                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page