(data stored in ACNUC7421 zone)

EMBL: CP001700.PE137

CP001700.PE137       Location/Qualifiers
FT   CDS_pept        complement(145960..146790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0137"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: tfu:Tfu_1719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69092"
FT                   /db_xref="GOA:C7QHF3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF3"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACU69092.1"
FT                   /translation="MKLSLNQATVKRLTLAEAAEGCVRAGIPAIGLWRDRVQEIGIEAA
FT                   AKIVRASGLEVTSLCRGGFMTAASAADRAAALADNKQAVLEAAGVGTDVLILVVGGLPS
FT                   GSKDLPAARGAVAEGVADLVPFAAEHGVKLAIEPLHPMFCADRAVVSTLGQALDIAEAF
FT                   PAEQVGVVVDTYHVWWDPQLEASIARAGKGNRILSYQECDWVVPLPADMLLGRGHVGDG
FT                   HIDFARMRSLVTAAGWTGYAEVEIFNQEIWDADGDRTIATVRSRHEAVSAASGL"
     atgaaactct ccctcaacca agccaccgtc aagcgcctca ccctcgccga ggccgccgaa        60
     ggctgcgtcc gcgcgggcat cccggccatc ggactctggc gcgaccgcgt ccaagagatc       120
     ggcatcgagg ccgccgccaa gatcgtgcgc gcatcaggcc tcgaggtcac cagcctctgc       180
     cgtggcggct tcatgaccgc cgcctccgcc gcggaccgcg ccgccgcgct cgccgacaac       240
     aagcaagcgg tgctcgaggc ggccggcgtc gggaccgatg tgctgatcct cgtcgtcggc       300
     gggctcccct ccgggtccaa ggacctgccc gccgcgcggg gcgccgttgc cgagggcgtc       360
     gccgatctgg tgccgttcgc ggccgagcat ggtgtgaagc tggcgatcga gccgctgcat       420
     ccgatgttct gcgccgaccg ggcggtggtc tccacgctgg ggcaggcgct cgacatcgcc       480
     gaggcgttcc cggccgagca ggtcggcgtc gtggtcgaca cctaccacgt ttggtgggat       540
     ccgcagctgg aggcgtcgat cgcccgtgcc ggtaagggaa atcggatcct ttcctaccag       600
     gagtgcgact gggtcgtgcc gctgccggcc gacatgctgc tgggtcgcgg gcacgtcggc       660
     gacggtcaca tcgacttcgc gcggatgcgc tcgctggtca ccgccgcggg gtggaccggc       720
     tatgccgagg tggagatctt caaccaggag atctgggacg cggacggcga ccggaccatc       780
     gccaccgtcc gctcccgcca cgaggcggtc agcgccgcct cgggtctgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page