(data stored in ACNUC7421 zone)

EMBL: CP001700.PE139

CP001700.PE139       Location/Qualifiers
FT   CDS_pept        complement(147112..148188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69094"
FT                   /db_xref="InterPro:IPR009334"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF5"
FT                   /inference="similar to AA sequence:KEGG:SCO2751"
FT                   /protein_id="ACU69094.1"
FT                   /translation="MAGFTSRVVYAAAHVVADPEADNRAGKPAVLDWDATLRFREHLWS
FT                   LGFGIADAMDTAQRGMGLDWSATQELIRRSGAAAKAVDAGNVPTLLACGAGTDQLSAGA
FT                   HSLPDIRAAYEEQLDVVEAAGARVILMASRALAASARSAEDYLTTYRALLDQAANPVIL
FT                   HWLGDMFDPALAGYWGSADIPTAMATVLELINANPQKVDGIKISLLNADHELELRRRLP
FT                   AGVRLYTGDDFNYPQLIKGDTTGHSDALLGIFDGIARPAAQALQALDRGDLQTYDRLMN
FT                   PTVALSRHIFEKPTFHYKTGLVFLAYLNGHQAHFRMVGALETARDTTHLTKLLHLAEAA
FT                   GVIDDPELAAQRFAAVVA"
     atggcgggct tcacttcgcg cgtcgtgtac gccgccgcgc atgtcgtggc ggatccggag        60
     gctgacaacc gcgcggggaa gcccgcggtc ctggactggg acgcgacgct ccgcttccgc       120
     gagcacctgt ggtcgctggg cttcggcatc gcggacgcca tggacaccgc gcagcgcggc       180
     atgggattgg actggtcggc gacgcaggaa ctgatccgac ggagcggcgc ggctgcgaag       240
     gcagtggacg cggggaacgt gcccacgctc ctggcgtgcg gcgcgggcac cgaccaactg       300
     tccgccggag cacattcgct ccctgacatc cgggccgcgt acgaggagca gcttgacgtg       360
     gtcgaggcgg caggcgcacg cgtgatcctg atggcgagcc gcgcgttggc cgcctccgca       420
     cgctcggccg aggactatct gacgacctac cgtgcactgc tggaccaggc cgcgaacccg       480
     gtgatcctgc actggctggg cgacatgttc gacccggcgc tggcgggcta ctggggctcc       540
     gccgacatcc ccaccgcgat ggcaacagtc ctggagctga tcaacgccaa cccgcagaag       600
     gtcgacggca tcaagatctc cctcctgaac gccgaccacg aactcgaact ccgccgccgc       660
     ctccccgcag gcgtccgcct ctacaccggc gacgacttca actaccccca actgatcaag       720
     ggcgacacca ccggccactc cgacgccctc ctcggcatct tcgacggcat cgcccgcccc       780
     gccgcacaag cactccaagc cctggaccgc ggcgacctcc agacctacga ccgcctgatg       840
     aacccgacgg tcgccctatc ccgccacatc ttcgagaagc ccaccttcca ctacaaaacc       900
     ggcctggtct tcctcgccta cctcaacggc caccaagccc acttccgcat ggtcggcgcc       960
     ctcgaaacag cccgcgacac cacgcacctg acaaagctcc tccacctcgc cgaagccgcc      1020
     ggcgtcatcg acgaccccga gctggccgca cagcgcttcg cggcggtggt cgcatga         1077
//

If you have problems or comments...

PBIL Back to PBIL home page