(data stored in ACNUC7421 zone)

EMBL: CP001700.PE14

CP001700.PE14        Location/Qualifiers
FT   CDS_pept        16485..16967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0014"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: tfu:Tfu_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68969"
FT                   /db_xref="GOA:C7QFN0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU68969.1"
FT                   /translation="MDVWSKEFAGRPECLAEARRFTYAVLGRGDGAHIAALVADELAGN
FT                   AIRHTASGRPGGEFILRLARFGNRCRVRVDDQGGPTTPEVCAATDFEEAGRGLTIVASL
FT                   SAQWGVEGDEHARSVWAEITFEEIPGISGPDGPAVDLPPQARARRKVGMTTEDWTR"
     atggacgtct ggtccaagga attcgccggc cggcccgagt gcctggccga ggcgcgccgc        60
     ttcacctacg ccgtgctcgg ccggggcgac ggggcgcaca tcgccgcgct ggtcgccgac       120
     gagctggcgg gcaacgccat caggcacacg gccagcggcc ggcccggcgg ggagttcatc       180
     ctgcggctgg cccggttcgg gaaccgctgc cgggtgcggg tcgacgacca gggcgggccc       240
     accacccccg aggtgtgcgc cgccaccgac ttcgaggagg ccgggcgcgg cctcaccatc       300
     gtcgcctccc tgtcggccca gtggggtgtc gagggcgacg agcacgcccg atcggtctgg       360
     gccgagatca cgttcgagga gatcccgggg atatccgggc ccgacggccc ggccgtcgat       420
     cttcccccgc aagccagagc acgaagaaag gtcggcatga cgacggagga ctggacgcgt       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page