(data stored in ACNUC7421 zone)

EMBL: CP001700.PE140

CP001700.PE140       Location/Qualifiers
FT   CDS_pept        complement(148197..149357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0140"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: sgr:SGR_4813 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69095"
FT                   /db_xref="GOA:C7QHF6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU69095.1"
FT                   /translation="MTRETVGIAMNGVTGRMGYRQHLLRSILAIRDQGGLALPDGRTVW
FT                   PEPILVGRNAEKIEALATRHGLDKWTTSLDEALADPSVTVYFDAQVTQARVPAITRAIE
FT                   AGKHIYTEKPTAETLDDAISLARIADAAGIKHGVVQDKLFLPGLLKLKRLVDSSFFGRI
FT                   LSVRGEFGYWVFEGDWQPAQRPSWNYRAEDGGGIILDMFPHWRYVLDHIIAPVRSVYAE
FT                   ARTDIPTRWDEQGREYKATADDAAYALFELEGGIVASLNSSWTTRVNREELVEFQIDGT
FT                   HGSAVAGLRNCKAQHRAATPKPVWNPDIPATEDFLAQWQEVPDNAVMDNGFKVQWEMFL
FT                   AHLVADAPYSHDLWAGARGVQLAELGAQSWREGRKVAVPELDRTGK"
     atgacacgcg aaacggtcgg catagcgatg aacggcgtca ccggacgcat gggctaccgg        60
     cagcacctgc tgcgctccat cctcgccatc cgcgaccagg gcggcctggc cctccccgac       120
     ggccgcacgg tctggcccga gccgatcctg gtcggtcgca acgccgagaa gatcgaggcg       180
     ctggccaccc ggcacggcct ggacaagtgg accacgtccc tggacgaagc cctggccgac       240
     ccctcggtga ccgtctactt cgacgcgcag gtcacgcagg cccgcgtccc ggccatcacc       300
     cgggcgatcg aagcgggcaa gcacatctac accgagaagc cgaccgccga gaccctggac       360
     gacgcgatca gcctcgcgcg catcgccgac gccgcgggca tcaagcacgg cgtggtccag       420
     gacaagctgt tcctgccggg cctgctgaag ctgaagcgac tggtcgactc cagcttcttc       480
     ggccgcatcc tgtccgtccg cggcgagttc ggctactggg tcttcgaggg ggactggcag       540
     ccggcgcagc ggccgtcgtg gaactaccgc gccgaggacg gcggcggcat catcctggac       600
     atgttcccgc actggcgcta cgtgctggat cacatcatcg cgccggtccg aagcgtctac       660
     gccgaagccc gcaccgacat cccgacccgc tgggacgagc agggccggga gtacaaggcc       720
     accgccgacg acgccgcgta cgccctcttc gaactcgaag gcggcatcgt cgcctccctg       780
     aactcctcct ggaccacccg cgtcaaccgc gaggaactgg tcgagttcca gatcgacggc       840
     acgcacggca gcgccgtcgc gggcctgcgc aactgcaagg cccagcaccg cgccgccacc       900
     ccgaagcccg tctggaaccc cgacatcccc gcgaccgagg acttcctcgc gcagtggcag       960
     gaggtcccgg acaacgcggt catggacaac ggattcaagg tccagtggga gatgttcctc      1020
     gcgcacctcg tcgccgatgc gccgtacagc cacgacctgt gggccggcgc ccgcggcgtg      1080
     cagctggccg aactcggcgc gcagtcctgg cgcgagggcc gcaaggtcgc cgtgccggag      1140
     ctcgaccgga ccgggaagtg a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page