(data stored in ACNUC7421 zone)

EMBL: CP001700.PE141

CP001700.PE141       Location/Qualifiers
FT   CDS_pept        149451..150509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0141"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: tfu:Tfu_1710 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69096"
FT                   /db_xref="GOA:C7QHF7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF7"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACU69096.1"
FT                   /translation="MSTQRSTPSPAPRRGGATLQQVADAAGVSLATASRVLNGSTRTVN
FT                   PELSEHVREVATRLRYVSHGPAQALARATTSLVGLLVHDVNDPYFSAVAAGAMRVARER
FT                   DLLVMVANTYRDPELELDYITRLGAQRARAILVAGSPPVDPALAKPLRERLLDYQQGGG
FT                   RVVSIGDQGPDIDAVLPANVEGARAAALHLTALGHREIGMVAGPRGLVTIADRSEGFRS
FT                   GLMDSDGDPVGHEIEGAFTRDGGYDATQRLLAAHPDVTAVFVMADVMAIGALAALRDAG
FT                   RRVPDDVSLVGFDDLPICADLMPALTTVRVDTEGMGEQAMRMVVSEVQDEGRAVVHSAT
FT                   ELIVRGSTGPAA"
     gtgtccacgc agcggtcaac accctcgccg gctccgcgcc gcggcggcgc caccctgcag        60
     caggtggccg acgccgcggg cgtctcgctg gccaccgcct cgcgggtgct caatggcagc       120
     accaggacgg tgaaccccga gctcagcgag cacgtccgcg aggtcgccac gcgcctgcgc       180
     tacgtctcgc acggcccggc gcaggccctc gcccgcgcga cgacctcgct ggtcgggttg       240
     ctggtccacg acgtcaacga cccgtatttc tccgccgtcg ccgccggtgc gatgcgggtg       300
     gcccgtgagc gggacctgct ggtgatggtc gcgaacacct accgcgaccc cgagctggag       360
     ctggactaca tcacccggtt gggcgcgcag cgcgcccgcg cgatcctggt cgccggctcg       420
     ccgccggtgg acccggcgct ggcgaagccg ctgcgcgagc ggctgctgga ctaccagcag       480
     ggcggcggtc gcgtggtgag catcggcgac cagggaccgg acatcgacgc cgtgctgccg       540
     gcgaacgtcg agggggcgcg cgcggcggct ctgcacctca ccgcgctcgg acaccgcgag       600
     atcggaatgg tcgccggacc acgcggactg gtgacgatcg ccgaccggtc cgagggcttt       660
     cgcagcggcc tgatggacag cgacggcgat ccggtcggcc acgagatcga gggcgccttc       720
     acccgcgacg gcggctacga cgccacgcag cgcttgctgg ccgcgcatcc cgacgtgacg       780
     gcggtgttcg tgatggccga cgtgatggct atcggcgcgt tggcggcgtt gcgtgacgcc       840
     ggacgtcgcg tgccggacga cgtcagcctg gtcggcttcg acgatctgcc gatctgcgcc       900
     gacctgatgc ccgcgctgac gacggtccgc gtcgataccg agggcatggg tgagcaagcg       960
     atgcgcatgg tggtgtccga ggtgcaggac gaggggcgcg cggtcgtgca cagcgctacg      1020
     gaactgatcg tgcgggggag cacgggaccg gccgcctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page