(data stored in ACNUC7421 zone)

EMBL: CP001700.PE142

CP001700.PE142       Location/Qualifiers
FT   CDS_pept        150596..151456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0142"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sgr:SGR_4335 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69097"
FT                   /db_xref="GOA:C7QHF8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACU69097.1"
FT                   /translation="MPVVLSAAFLHASWNAILKFVSDKLTASLLMTVSSGVLAAIGVFL
FT                   LPAPDRASWVLLLVSAALHVGYFLMLIKTFEIGDFNQVYPLARGLSPVVVAFFATALGD
FT                   PMSRHQTVGIAVVCGGLTTLVFSAGRPKRAQGKALFWAAMTGLSIATYTVTDGVAVRHS
FT                   KTAAGYTAWMMLAESTLMTAACVAIMTRRGRVSTAAGLLPTLRKLSRGDVLRGVIAGAL
FT                   SLFAYGLVLWAQTRGALAAVSALRETSVIFGAALGSVFLREPFGRYRIFAAVAIAGGIL
FT                   ILEAA"
     gtgcccgtcg tcttatccgc cgccttcctg cacgcgagct ggaacgcgat tctcaagttc        60
     gtctccgaca aactcaccgc atcgctgctg atgacggtgt cgtccggagt gctggcggcg       120
     atcggcgtct tcctgctgcc cgcgccggat cgcgcgtcgt gggtgctgtt gctggtctcg       180
     gcggcgttgc acgtcggcta tttcctgatg ctgatcaaga ccttcgagat cggcgacttc       240
     aaccaggtct acccgctggc gcgagggctg tcgccggtgg tggtggcgtt cttcgccacc       300
     gccctgggcg atccgatgtc gcggcaccag accgtgggca tcgcagtggt ctgcggtggg       360
     ctgacgacgc tggtgttctc cgccggacga cccaagcgcg cgcagggcaa agcactgttc       420
     tgggcagcga tgaccggtct gtcgatcgcg acgtacacgg tcaccgacgg tgtcgcggtg       480
     cggcactcga agaccgccgc gggctacacc gcctggatga tgctcgcgga gagcacgctg       540
     atgacggccg cgtgtgtggc gatcatgacg cggcgcggcc gggtgtccac cgcggcggga       600
     ctgcttccga cgctgaggaa actgagccgc ggcgacgtgc tgcgcggagt gatcgcggga       660
     gcactgtcgc tgttcgccta cggcctggtg ctgtgggcgc agacgcgcgg ggcgctcgcg       720
     gcggtgtcgg cgctgcggga gaccagcgtg atcttcggcg cggcgctcgg gtcggtgttc       780
     ctgcgcgagc ccttcgggcg gtatcggatc ttcgcggcgg tggcgatagc cggtgggatc       840
     ctgattctcg aggcggcata a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page