(data stored in ACNUC7421 zone)

EMBL: CP001700.PE143

CP001700.PE143       Location/Qualifiers
FT   CDS_pept        complement(151637..152257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0143"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: sco:SCO5749 two-component
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69098"
FT                   /db_xref="GOA:C7QHF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHF9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU69098.1"
FT                   /translation="MNDAHRASAPSDGDIKILLVDDRPENLLALESILGSLGHELVTAA
FT                   SGEQALRAVLREEFAVILLDVRMPGMDGFEVAAHIRLRERSRDTPIIFLTAAGDGPHQT
FT                   LRGYAAGAADYLTKPFDPWVLRAKVGVFAELHRKNRQLKEQAEMLRETAGVTPRMLDEL
FT                   SNRLGAIEGTLALLIDQSGREGPVGRLERRVVRMRAALDAVRV"
     gtgaacgacg cgcaccgcgc ctcggcgccg tccgacggcg acatcaagat cctgctggtc        60
     gacgaccgcc ccgagaacct gctggcgctg gagtccatcc tgggctccct gggccacgaa       120
     ctggtcaccg cggcctccgg cgagcaggcc ctgcgcgcag tcctgcgcga ggagttcgcg       180
     gtgatcctgc tggacgtccg catgcccggc atggacggct tcgaggtggc ggcgcacatc       240
     cgcctgcgcg aacgctcccg cgacaccccg atcatcttcc tcaccgccgc cggcgacggc       300
     ccgcaccaga ccctgcgcgg ctacgccgcc ggcgccgccg actacctgac caagcccttc       360
     gacccctggg tcctgcgcgc caaggtcggc gtcttcgccg agctccaccg caagaaccgc       420
     cagctgaagg agcaggcgga gatgctgcgc gagaccgccg gcgtcacccc ccggatgctc       480
     gacgagctgt cgaaccggct cggcgccatc gagggcaccc tggccctgct gatcgaccag       540
     agcggacgcg agggaccggt cgggcggctg gagcggcggg tcgtgcggat gcgggcggct       600
     ttggacgcgg tgcgggtctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page