(data stored in ACNUC7421 zone)

EMBL: CP001700.PE144

CP001700.PE144       Location/Qualifiers
FT   CDS_pept        complement(152254..155613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0144"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: sgr:SGR_1773 putative two-component system
FT                   sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; GAF domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; response regulator receiver; histidine
FT                   kinase A domain protein; GAF domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69099"
FT                   /db_xref="GOA:C7QHG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG0"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACU69099.1"
FT                   /translation="MTLQSDARTDPELDRQLGAILEVAQAVARGDLSRKIALSGDIVDG
FT                   PVAELARTIDAMVGQLSGFASEVIRVARELGTEGRLGGQATVEHAEGIWRDITDSVNSA
FT                   ARNLTAQVRDIAGVTTAVAQGDLTQKITVEVAGEMLELKDTINTMVDQLSGFADEVTRV
FT                   SLEVGTEGRLGGQARVPGVAGTWKDLTDSVNSMADNLTTQVRNIAQVATAVASGDLTQS
FT                   ITVDARGEILELKTTLNKMVDRLGTFADEVTRVAREVGTEGKLGGQATVRGVAGTWKDL
FT                   TDNVNAMANNLTSQVRNIAQVTTAVANGDLSKRIDVEARGEILELKTTLNTMVDRLSAF
FT                   ASEVTRVAREVGTEGKLGGQATVEDVSGTWQRLTESVNELASNLTTQVRAIAEVATAVT
FT                   AGDLTRLITVEAKGEVADLKNNINQMIGNLRETTRRNDQQDWLNTNLARMSGLMQGQRD
FT                   LDAISALIMSELTPLVNAQYGAFYLARKESGTKVLNLIASYGVDRESPDVTSRFRLGQG
FT                   MVGQAAVERKPIMIQHAPVDYIRISSGLGSAPPSSVAVLPVLFENEVMAVIELASFHSF
FT                   DEVHRALMESLMEMVGVTVNTITANTRTEELLGESRRLADELKARTDELQMQQKELRRS
FT                   NAELEEKAELLARQNQDIEVKNSEIEQARQELEERANQLTMSSRYKSEFLANMSHELRT
FT                   PLNSLLILARLMSDNAEGNLTERQVEYAETIHGAGSDLLQLINDILDLSKIEAGRMDVQ
FT                   PARIAVSQLVDYVEATFRPQTEQKGLELRVRVAPSVPAHLFTDEQRLQQVLRNLLSNSV
FT                   KFTETGHVELVVDTVGDVVLGGPEDSNEVTLEPAVSFAVSDTGIGIVDDKIQTVFEAFQ
FT                   QEDGTTSRRYGGTGLGLSISREIAKLLGGGIRAESQRGRGSTFTLFLPHAVGPDGAAVF
FT                   GSTGSLGYGTSPGPTGAIAEPAPTLPMIPEQAPHPDLYLPSTDLHAAGSDITFDGEKIL
FT                   IVDDDIRNVFALTSVLEQHGCAVLNAENGRAGLEALERADDVALVLMDVMMPEMDGYAT
FT                   MAAIREIDRYKNLPIIALTAKAMRGDREKSIEAGASDYVTKPVDTPHLLTVMRGWLDAE
FT                   TGAQPAPGGPAQ"
     atgacgctgc aatcggatgc caggacggac cccgagctgg accgccagct cggagcgatc        60
     ctggaggtgg cccaggcggt ggcccgaggc gacctgtcgc gcaagatcgc gctgtccggg       120
     gacatcgtcg acgggccggt ggccgaactc gcccggacca tcgacgcgat ggtcgggcag       180
     ctgtccggct tcgcctccga ggtgatccgg gtcgcccgcg agctcgggac cgaggggcgc       240
     ctcggcgggc aggccacggt cgagcacgcc gagggcatct ggcgcgacat caccgactcg       300
     gtgaactccg ccgcccgcaa cctcaccgcg caggtccgcg acatagcggg agtcaccacc       360
     gcggtcgcgc agggcgacct gacccagaag atcacggtcg aggtcgccgg ggagatgctc       420
     gagctgaagg acaccatcaa cacgatggtc gaccagctct cagggttcgc cgacgaggtc       480
     acgcgcgtct cgctggaggt gggcaccgag ggccggctgg gcggccaggc gcgcgtcccc       540
     ggcgtcgccg gcacgtggaa ggacctcacc gactcggtga actccatggc cgacaacctc       600
     accacccagg tgcgcaacat cgcgcaggtc gccacggcgg tggcctccgg cgacctgacg       660
     cagtccatca ccgtcgacgc ccgcggcgag atcctggagc tgaagaccac cctgaacaag       720
     atggtggacc ggctcggcac gttcgccgac gaggtgaccc gcgtggcgcg cgaggtcggc       780
     accgagggca agctcggcgg ccaggccacg gtccgcggcg tcgcggggac ctggaaggac       840
     ctcaccgaca acgtcaacgc gatggcgaac aacctgacca gccaggtccg caacatcgcg       900
     caggtgacca ccgcggtcgc caacggcgac ctgtccaagc gcatcgacgt cgaggcgcgc       960
     ggggagatcc tggagctgaa gaccacgctg aacacgatgg tggaccggct ctccgccttc      1020
     gcctccgagg tcacccgcgt cgcccgcgag gtcggcacgg agggcaagct cggcggtcag      1080
     gccactgtcg aggacgtctc agggacctgg cagcgcctca ccgagtccgt gaacgaactg      1140
     gcgtcgaacc tgaccaccca ggtccgcgcg atcgccgagg tcgccaccgc ggtgaccgcc      1200
     ggcgatttga cccggctgat cacggtcgag gccaagggcg aggtcgccga cctgaagaac      1260
     aacatcaacc agatgatcgg caacctgcgc gagaccacgc gccgcaacga ccagcaggac      1320
     tggctgaaca ccaacctggc gcgcatgagt ggcctgatgc agggccagcg cgacctggac      1380
     gcgatctccg cgctcatcat gagcgagctg acaccgctgg tgaacgccca gtacggcgcc      1440
     ttctacctgg cgcgcaagga atccggcacg aaggtgctca acctcatcgc gtcctacggc      1500
     gtggaccgcg agtcccccga cgtcacctcg cgcttccgcc tgggccaggg catggtcggc      1560
     caggccgcgg tcgagcgcaa gccgatcatg atccagcacg cgccggtgga ctacatccgc      1620
     atctcctccg ggctgggctc ggcgccgccg tcctcggtcg cggtgctgcc ggtcctgttc      1680
     gagaacgagg tcatggcggt catcgagctg gccagcttcc acagcttcga cgaggtccac      1740
     cgggccctga tggagtcgct gatggagatg gtcggcgtca cggtcaacac catcaccgcc      1800
     aacacccgca ccgaggagct gctcggggag tcccggcggc tggccgacga gctcaaggcc      1860
     cggaccgacg agctgcagat gcagcagaag gagctgcgcc gctccaacgc cgagctggag      1920
     gagaaggccg agctgctggc ccggcagaac caggacatcg aggtcaagaa ctccgagatc      1980
     gagcaggcgc gccaggagct cgaggagcgc gcgaaccagc tcacgatgtc ctcgcgctac      2040
     aagtccgagt tcctggcgaa catgtcgcac gagctgcgca ccccgctgaa cagcctgctg      2100
     atcctggccc ggctgatgtc cgacaacgcc gagggcaacc tcaccgagcg ccaggtggag      2160
     tacgccgaga ccatccacgg cgcgggcagc gacctgctcc agctgatcaa cgacatcctg      2220
     gacctgagca agatcgaggc cgggcgcatg gacgtgcagc ccgcccgcat agcggtcagc      2280
     cagctggtgg actacgtgga ggcgaccttc cgcccgcaga ccgagcagaa gggcctggag      2340
     ctgcgggtgc gggtcgcgcc ctcggtcccg gcgcacctgt tcaccgacga gcagcggctg      2400
     cagcaggtac tgcgcaacct gctgtcgaac tcggtgaagt tcaccgagac cgggcatgtc      2460
     gagctggtcg tggacaccgt cggcgacgtc gtgctcggcg gcccggagga cagcaacgag      2520
     gtcaccctgg agcccgcggt gtccttcgcg gtctccgaca ccggcatcgg catcgtggac      2580
     gacaagatcc agaccgtctt cgaggccttc cagcaggagg acggcaccac ctcgcgccgc      2640
     tacggcggca ccgggctggg actgtccatc agccgggaga tcgccaagct gctcggcggc      2700
     ggcatccgcg ccgagagcca gcgcggccgc ggctcgacgt tcaccctgtt cctgccgcac      2760
     gccgtcggac cggacggcgc cgcggtgttc ggcagcaccg gcagcctggg ctacggcacc      2820
     agtccgggcc cgacgggagc gatcgccgaa cccgcgccga ccctgccgat gatccccgaa      2880
     caagcaccgc atccggacct gtacctgccc tcgacggacc tgcacgcggc cggctcggac      2940
     atcaccttcg acggtgagaa gatcctcatc gtcgacgacg acatccgcaa cgtcttcgcc      3000
     ctgacctcgg tcctggagca gcatggctgc gcggtcctga acgccgagaa cggccgcgcc      3060
     ggcctggagg ccctggaacg cgccgacgat gtggcgctgg tcctgatgga cgtgatgatg      3120
     ccggagatgg acggctacgc cacgatggcc gcgatccgcg agatcgaccg ctacaagaac      3180
     ctgccgatca tcgccctgac cgccaaggcg atgcgcggcg accgggagaa gtccatcgag      3240
     gccggcgcct cggactacgt gaccaaaccc gtggacaccc cgcatctgct gaccgtcatg      3300
     cgaggctggc tcgacgccga gaccggcgcc cagcccgcac caggaggccc ggcccagtga      3360
//

If you have problems or comments...

PBIL Back to PBIL home page