(data stored in ACNUC7421 zone)

EMBL: CP001700.PE145

CP001700.PE145       Location/Qualifiers
FT   CDS_pept        155821..157098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0145"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: sgr:SGR_1774
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69100"
FT                   /db_xref="GOA:C7QHG1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG1"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ACU69100.1"
FT                   /translation="MAPRTPRTPLPRDRPEEAVRLTLLSQAGELLAGTLDRRRLAALAS
FT                   QLIVPRLADWVALYPPAADHSIVSSSWSPEHLWHREERKLDALAAALADWHPPTGEDGH
FT                   VPGSGSGRWPVQVASPYGQALPIPLAARGVSLGTLVLGGPGKGGFAGATLPLLMELAGR
FT                   ISGALDNARQYAEQVEIVRGLQRSLLPPSLPTVDGLDIGVVYEAASNSDGVHVGGDFYD
FT                   VFPISRKVWGFAVGDVCGTGPEAAALTGLARHSLRLLAREGRSPVTVVERLNQAVLEEG
FT                   ELAGDAGRFITLLYGEVEPRPDGSAQLVLVCAGHPLPLVLRQDGSVRAAANPQPLLGVL
FT                   PDPTLYAEDVELGAGEVLLVYTDGASERRNGRQMLGDEGVAAALAGCSGMTAPGVVARV
FT                   RQAVADFGSSGTRDDLALLALRAYKG"
     atggcccctc gcaccccccg tacacctctt ccccgagacc gccccgaaga agcggtccgg        60
     ctgaccctgc tttcccaggc cggcgaactt ctggccggca cgctggaccg gcgccgcctg       120
     gcagccctgg cttcccagct catcgtgccg agactggccg actgggtggc cctgtatccg       180
     ccggccgccg atcactcgat cgtgtcatcg tcctggagcc cggaacacct ctggcaccgg       240
     gaggagcgca agctggacgc cctcgccgcg gcgctggcgg actggcaccc gccgacgggt       300
     gaggatggtc acgttccagg atccggatcc ggccggtggc cggtccaagt ggcctcgccc       360
     tacggccagg cgctgccgat cccgctcgcc gcgcgcggcg tgtcgctggg cacgctggtc       420
     ctcggcggcc cgggcaaggg cggattcgcc ggcgcgacgc tgccgctgct catggagctg       480
     gcgggacgga tctcgggggc gctggacaac gcgcggcagt acgccgagca ggtggagatc       540
     gtccggggtc tgcaacgctc gctgctgccg ccctcgctgc ccaccgtcga cgggctcgac       600
     atcggcgtgg tctacgaggc cgcctccaac agcgacggcg tccacgtcgg cggcgacttc       660
     tacgacgtgt tcccgatcag ccgcaaggtc tggggcttcg cggtcggcga cgtctgcggc       720
     accggcccgg aggccgcggc gctgaccggg ctggcccggc actccctgcg gctgctggcc       780
     cgcgagggcc gctcgccggt cacggtggtc gagcggctga accaggcggt gctggaagag       840
     ggcgaactcg ccggcgacgc gggccggttc atcaccctgc tgtacggcga ggtcgaaccc       900
     cgccccgacg gctcggcgca gctggtactg gtctgcgccg gccacccgct gccgctggtc       960
     ctgcggcagg acggcagcgt gcgcgccgcc gccaacccgc agccgctgct cggggtcctg      1020
     cccgacccga cgctgtacgc cgaggacgtg gagctcggcg ccggggaggt cctgctggtc      1080
     tacaccgacg gcgcgagcga gcgccgcaac ggccgccaga tgctcggcga cgagggcgtg      1140
     gcggccgcgc tggcgggctg ttcgggcatg accgcgccgg gcgtggtggc gcgggtgcgc      1200
     caggcggtcg cggacttcgg atcctccggg acccgcgacg acctggcgct gctggccctg      1260
     cgggcctaca agggctga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page