(data stored in ACNUC7421 zone)

EMBL: CP001700.PE146

CP001700.PE146       Location/Qualifiers
FT   CDS_pept        complement(157217..158200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69101"
FT                   /db_xref="GOA:C7QHG2"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69101.1"
FT                   /translation="MTELDTREDDWARGVFDRARTGRHEPHWAPDAAGAARLSKRRQTR
FT                   YRATGALAVMAVAGLSATAFTALGGNVFHARDTVSPGSSGPILWPGLDLTKYLDVHESY
FT                   MVAAGHQYEANRMPAVSLATTSTVLQRLDPGLKHVRTVSGHQDLDITPTPPGVTTMAVQ
FT                   ADGIWSPNGDLSTFPPASSNFSPVTTPFGYVSIATMGPHVAQDANMENKPCGLGTLVTS
FT                   TRIPAPTAWSPCVRSHQSDGSDILVTHAVNLPAGAVTVAARVFPDTSTVQVTASSVFGL
FT                   QEGPAAGSSTPATPAKFDAGPPLNPVPWTDDSLAQVLTGPDVKGLP"
     atgacagagc tcgacacccg agaggacgac tgggcccgcg gcgtcttcga ccgcgcccgg        60
     accggccggc acgaaccgca ctgggctccc gacgccgcag gcgccgcccg actgagcaag       120
     cggcgccaga cccggtaccg ggcgaccgga gccctggccg tgatggcggt cgcgggcctg       180
     tccgcgacgg ctttcaccgc cttgggcggc aacgtcttcc acgcccggga cacggtctcg       240
     cccggctcga gcggcccgat cctctggccc ggtttggacc tcaccaagta cctcgacgtc       300
     cacgagtcgt acatggtcgc tgccggccac cagtacgagg cgaaccgtat gcccgctgtc       360
     agcctggcga cgaccagcac cgtcctgcag cgtctggatc cgggcctgaa gcacgtccgc       420
     accgtgtccg gccatcagga cctcgacatc acgccgaccc cgcccggcgt caccaccatg       480
     gcggtccagg cggacggcat ctggtcgccg aacggcgacc tctcgacctt cccgcctgcg       540
     agctccaatt tcagtcccgt cacgacgccc ttcggctatg tgtccatcgc cacgatgggc       600
     ccgcacgtcg cacaagacgc caacatggag aacaagccct gcggactggg gaccctcgtg       660
     acctccaccc ggattccggc gccgactgcc tggtcgccct gtgtgcggtc gcatcaaagc       720
     gacggctccg acatcctcgt cacccacgcg gtgaacctcc cggccggcgc ggtgacggtc       780
     gccgcgcgcg tgtttcccga cacctcgacg gtccaggtca cggccagcag cgtcttcggc       840
     ctccaggagg gcccggcggc cgggagttcc acaccggcca caccggccaa gttcgacgcc       900
     gggccgcccc tgaacccggt cccgtggacc gacgacagcc tcgcccaggt cctcaccggg       960
     ccggatgtca agggattgcc gtaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page