(data stored in ACNUC7421 zone)

EMBL: CP001700.PE147

CP001700.PE147       Location/Qualifiers
FT   CDS_pept        complement(158225..158737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0147"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; KEGG: sen:SACE_7161 RNA
FT                   polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69102"
FT                   /db_xref="GOA:C7QHG3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG3"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ACU69102.1"
FT                   /translation="MDKSYEAEFAELVAAKGAALRRTAYLMCADWHLAEDLVQTVFVKV
FT                   HLHWRRIKRQETFDAYLRTTLFRAYLDTRRAKWRRETPAEYLPELEAPGTEPGDDRDVL
FT                   VAALRRIPPRQRAVLVLRYWEDLSVEETARLLGCAAGTVKSQAARGLAALRPLLAGTPF
FT                   ESVTAEH"
     atggacaagt cctacgaggc ggagttcgcc gaactcgtcg ccgccaaggg cgcggcgctt        60
     cggcgcaccg cctatctgat gtgcgcggac tggcatctgg ccgaagacct ggtccagacc       120
     gtcttcgtca aggtccatct gcactggcgc cggatcaagc gccaggaaac cttcgacgcc       180
     tacctgcgta cgacgctctt ccgcgcctac ctcgacaccc gccgcgccaa gtggcgccgg       240
     gagactccgg ccgagtacct gccggagctc gaggcaccgg gcaccgaacc cggcgacgac       300
     cgcgacgtgc tggtcgcggc gctgcgccgg atcccgcccc ggcagcgtgc cgtcctggtc       360
     ctccgctact gggaggacct gagcgtggag gagaccgcaa ggctcttggg gtgcgccgcg       420
     ggcaccgtca agagccaggc cgccagggga ctcgccgcgc tgcgcccgct gttggccggc       480
     acgccgttcg agtccgtcac cgcagaacac tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page