(data stored in ACNUC7421 zone)

EMBL: CP001700.PE148

CP001700.PE148       Location/Qualifiers
FT   CDS_pept        complement(158807..160081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0148"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   nca:Noca_4538 cyclopropane-fatty-acyl- phospholipid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69103"
FT                   /db_xref="GOA:C7QHG4"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG4"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ACU69103.1"
FT                   /translation="MTHPAPTPLIDTDRWPDLARVPDRPVRARIARRLFTHALKDVPVT
FT                   VVAPNGLALAGAGVPGGGGPVLRVRRPKEFLNRLGSDGLIGFGEAYQTGAWDTETGDEL
FT                   VALLTELASRLEDLVPKPLQRMRSLAAHHMPRDQDGDRHGARHNAHAHYDLSNDMFEAF
FT                   LDPSMTYSAALFDPVADADGPGDLHAAQLRKIDAMLDAAGVRKGTRLLEIGSGWGGLAI
FT                   KAAGERGATVLTVTLSEEQQELARRRIAAAGLAGRIEVRLADYREVAEEQPFDAVVSVE
FT                   MIEAVGRRYLPDYFQAIERNLARGGRVAVQAITMAHHRMLATQDSYSWIHKYVFPGGLI
FT                   PSIPELDFAAETAGLRLAARRDFGLDYARTLRAWRHRFEENWPKVAGHGFDEVFRRTWR
FT                   FYLAYCEAGFASGYLGVSQLTYTRP"
     atgacccacc ccgcgcccac ccccctgatc gacaccgacc gctggcccga cctcgcgcgg        60
     gttccggacc ggccggtgcg ggcgcgcatc gcgcgccgct tgttcaccca cgcgctcaag       120
     gacgtcccgg tcaccgtggt ggcgcccaac ggactggcgc tggccggcgc gggcgtcccc       180
     ggcggcggcg gaccggtgct gcgcgtgcgg cggcccaagg agttcctgaa ccggctgggc       240
     tcggacggcc tgatcggctt cggcgaggcc taccagaccg gcgcgtggga caccgagacc       300
     ggcgacgagc tggtcgcgct gctcaccgag ctggcctccc ggctggagga cctggtcccc       360
     aagccgctgc agcggatgcg cagcctcgcg gcccaccaca tgccccgcga ccaggacggc       420
     gaccggcacg gggcgcgcca caacgcgcac gcgcactacg acctgtccaa cgacatgttc       480
     gaggcgttcc tcgacccgtc gatgacctac tccgcggcgc tgttcgaccc cgtcgccgac       540
     gccgacggtc ccggcgacct gcacgccgcg cagctccgca agatcgacgc gatgctcgac       600
     gcggccggcg tgcgcaaggg cacccggctg ctggagatcg gctccggctg gggcggtctg       660
     gcgatcaagg cggccggcga gcgcggcgcc acggtgctga ccgtgaccct gtcggaggag       720
     cagcaggagc tggcgcgcag gcgtatcgcg gcggcgggcc tggcgggacg gatcgaggtg       780
     cgcctggccg actaccgcga ggtcgccgag gagcagccgt tcgacgccgt ggtctcggtg       840
     gagatgatcg aggcggtcgg ccgccgctac ctgccggact acttccaggc catcgagcgc       900
     aacctggccc gcggcggccg ggtcgccgtc caggccatca ccatggccca ccaccgcatg       960
     ctggcgaccc aggactcgta ctcctggatc cacaagtacg tcttccccgg cggtctgatc      1020
     ccctcgatcc ccgagctgga cttcgccgcc gagaccgccg gcctgcgcct ggcggcccgc      1080
     cgcgacttcg gcctggacta cgcccgcacc ctgcgcgcct ggcgccaccg cttcgaggag      1140
     aactggccga aggtcgccgg gcacggcttc gacgaggtct tccgccgcac ctggcggttc      1200
     tacctggcct actgcgaggc cggattcgcc tcgggctacc tcggggtctc gcagctcacg      1260
     tacacgcggc cgtga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page