(data stored in ACNUC7421 zone)

EMBL: CP001700.PE149

CP001700.PE149       Location/Qualifiers
FT   CDS_pept        complement(160146..160928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_2642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69104"
FT                   /db_xref="GOA:C7QHG5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG5"
FT                   /inference="similar to AA sequence:KEGG:SGR_2642"
FT                   /protein_id="ACU69104.1"
FT                   /translation="MSREEIHPASEPRLDPPVHPVRGGVVGVVLLAHGGKETSHEAPHR
FT                   RGGPVTRMRMIARAVAPRLAGRGVAVHTMCFRYQGWNGAERAPVPDVWWAAARLTERYG
FT                   EVPLVLAGHSLGGRAVVNAADAPGVVGVLGLAPWLPAQEPTGQLAGRRLLLAHGTRDRV
FT                   TSPRSSYEYAARARAEGHDVARIVLPGSGHTMLSRARDWNRLVLAFSHTCLLEQHVVAA
FT                   DANRTRPPRYADVIAEAFQAAAPEGLQRVLTPAGRVRS"
     gtgagcaggg aagaaattca tcccgcatcc gaaccccgcc tcgacccgcc ggttcatccg        60
     gtccgcggcg gcgtcgtcgg cgtcgtcttg ttggcgcacg gcggcaagga gacctcgcat       120
     gaggcgccgc atcggcgcgg cggtcccgtg acgcggatgc gcatgatcgc gcgggcggtg       180
     gcgccgcggc tggcggggcg cggggtggcg gtgcacacca tgtgcttccg gtatcagggg       240
     tggaacggtg ccgagcgggc gccggtgccg gatgtgtggt gggctgccgc gcggctgacc       300
     gagcggtacg gcgaggtgcc gctggtgctg gccgggcatt cgctcggcgg gcgggccgtg       360
     gtgaacgccg ccgacgcgcc gggggtggtc ggcgtgctcg ggctggcgcc gtggctgccg       420
     gcgcaggagc cgaccgggca gttggccggg cgccggctgc tgttggcgca cgggacgcgg       480
     gaccgcgtca cctcgccgcg ttcctcgtac gaatacgccg cgcgcgctcg ggcagaagga       540
     cacgatgtcg cgcgcatcgt gctccccggc tccgggcaca ccatgctgtc ccgggcccgg       600
     gattggaacc ggcttgtcct ggcgttcagt catacatgcc ttctcgaaca gcacgtcgtg       660
     gcggcggacg cgaaccgaac ccggccgccc cgctacgccg acgtgatcgc cgaggccttc       720
     caggcggccg cccccgaggg cttgcaacga gttctgaccc ccgccgggcg cgtccgcagc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page