(data stored in ACNUC7421 zone)

EMBL: CP001700.PE15

CP001700.PE15        Location/Qualifiers
FT   CDS_pept        16967..17629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0015"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68970"
FT                   /db_xref="GOA:C7QFN1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFN1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU68970.1"
FT                   /translation="MALHVDYAAQRAFSRIIAGLRSARLDAELSQNALATGLPVRGRAV
FT                   SEWETGAIEPTLGHLIQWSWELGRRLVIVGRDGELRYGPVRQRPGELWEAFERRRLAVP
FT                   LRNRRLALGMAQGELGELVGVSRDSIQRWELVRVPPRPIAHVVWAQKLGYSLDTRPVAD
FT                   GGPRLRRVGSAGLALPGLSGQIGQQGQPGLTGQAERSASGPGSPAGELRAAADGRRG"
     atggcgctgc acgttgacta cgcggcacaa agggccttct cacggatcat cgccggtctg        60
     cgctcggccc gcttggacgc cgaactctcg cagaacgccc tcgccaccgg gctgccggtc       120
     cggggcaggg cggtctccga gtgggagacc ggggcgatag aaccgaccct gggccacctg       180
     atccagtggt cctgggaact ggggcggcgg ctggtgatcg tcgggcgcga cggcgaactg       240
     cgctacggcc cggtgcgcca gcggccgggc gagttgtggg aggccttcga gcgacggcga       300
     ctggccgtcc cgttacggaa ccgccgcctg gccttgggta tggcgcaagg cgaactcggc       360
     gaactcgtcg gtgtcagccg cgattcgatc cagcggtggg agctggtccg cgtgcccccg       420
     agaccgatcg cgcacgtcgt gtgggcgcag aaactcgggt actcactgga tactcgccct       480
     gtcgcggacg gcggcccgcg tctgcggcgt gtcggctccg cggggctggc gctgccagga       540
     ctgtcagggc agatagggca gcaaggacaa ccagggctga cgggacaagc agagcgctcg       600
     gcgtccggac ccggctcgcc cgccggtgag cttcgagccg ctgcggacgg tcggcgtgga       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page