(data stored in ACNUC7421 zone)

EMBL: CP001700.PE150

CP001700.PE150       Location/Qualifiers
FT   CDS_pept        complement(160949..161347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0150"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   blj:BLD_1980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69105"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG6"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACU69105.1"
FT                   /translation="MTGPATPETYRAIAELDGEWWVVTVPDLRGVYTQGRTYEQARAMA
FT                   RDAIATMLDTAPDRVAVAMEVRLPGHAEDTISEVARARAARDEAAAAEQRKLRESARRL
FT                   KAAGVKVVDAAVLLGVSKQRVYQLLTDH"
     gtgaccggac ccgcgacccc cgagacctac cgtgccatcg ccgagttgga cggcgagtgg        60
     tgggtggtca ccgtcccgga cctgcggggt gtgtacacgc aggggcggac ctacgagcaa       120
     gctcgggcca tggcccgcga cgcgatcgcc acgatgctcg acaccgctcc ggaccgggtc       180
     gccgtcgcga tggaggtccg gcttccgggc cacgccgaag acaccataag cgaggtggcg       240
     cgggctcggg ccgcccgcga cgaggccgcc gcggccgaac aaaggaagct ccgggagtcc       300
     gcgcgcagac tcaaggcggc cggcgtgaag gtcgtcgacg cggcagtcct gctgggcgtc       360
     agcaagcagc gtgtctacca gctacttaca gatcactag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page