(data stored in ACNUC7421 zone)

EMBL: CP001700.PE151

CP001700.PE151       Location/Qualifiers
FT   CDS_pept        complement(161344..161532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0151"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: mar:MAE_55720
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69106"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG7"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ACU69106.1"
FT                   /translation="MKRRDLLKALSDIAAEASVDFELVRHGGSHDIYRVGALHLTIPRH
FT                   TEISELLAKKILKEASQ"
     gtgaaacggc gtgacctgct gaaagcgctc tcagatatcg ccgctgaggc gtcagtcgac        60
     ttcgagctcg tccgccacgg cggaagtcac gacatctacc gtgtcggcgc actccacctg       120
     actatccctc ggcacactga gatctccgaa cttctagcca agaagatcct taaggaggcg       180
     agccagtga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page