(data stored in ACNUC7421 zone)

EMBL: CP001700.PE152

CP001700.PE152       Location/Qualifiers
FT   CDS_pept        complement(161660..162997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0152"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: fal:FRAAL6227 putative NADH
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69107"
FT                   /db_xref="GOA:C7QHG8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG8"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACU69107.1"
FT                   /translation="MGKASGNGKAIPRILIVGGGYVGMYTAHRILKKLGKDEALVTVVD
FT                   PRSYMTYQPFLPEAAAGSLSPRHVVVPLRSVLKRAEVLTARVTDIDQNRKVATIEPIAG
FT                   EPYELEFDQLVIAVGSIARTLPIPGLAENGIGFKQIEEAIALRNHVLGQMDIAATTKDE
FT                   KIRRRALTFVFIGGGFAGIEAIAELEDMARDACKIYPNIRPEDMRWVMVEGSGRILPEV
FT                   RPALGEYTVHELEKRGIQVKLNTFLESCVNRRVQLSDGTKMVASTIVWTAGVKPNPVVQ
FT                   RFGVPLGERGHVKAGATLQVEGFADVWSAGDGAQVPDLANPGKWCSPSAQHAVRQAKQL
FT                   ADNVVAAVRGFEPREYKHKHVGSVASLGLHKGVADVYNIRLRGWPAWFMHRTYHMSRVP
FT                   TFNRKIRVIADWTLALFFRREAVGLGSIERPRDEFAEAAGEQRKAA"
     gtgggtaagg cgagcgggaa cggcaaggcg atccctcgga ttctgatcgt gggcggcggc        60
     tacgtcggga tgtacacggc gcaccgcatc ctcaagaagc tcggcaagga cgaagcactg       120
     gtcacggtcg tcgacccgcg ctcgtacatg acctaccagc cgttcctgcc cgaagcggcg       180
     gccggctccc tgtccccgcg ccacgtcgtg gtgccgctgc gctcggtgct caagcgcgcc       240
     gaggtgctca ccgcgcgggt caccgacatc gaccagaacc gcaaggtcgc cacgatcgag       300
     ccgatcgccg gcgagcccta cgagctggag ttcgaccagc tggtgatcgc cgtgggctcg       360
     atcgcgcgca ccctgccgat cccgggcctg gccgagaacg gcatcggctt caagcagatc       420
     gaagaggcca tagcgctgcg caaccacgtc ctgggccaga tggacatcgc ggccaccacc       480
     aaggacgaga agatccgccg ccgcgcgctg accttcgtct tcatcggcgg cggcttcgcc       540
     ggcatcgagg cgatcgccga gctggaggac atggcgcgcg acgcctgcaa gatctacccg       600
     aacatccgcc cggaggacat gcgctgggtg atggtcgagg gctccgggcg catcctgccc       660
     gaggtgcggc cggccctggg cgagtacacc gtccacgagc tggagaagcg cggcatccag       720
     gtcaagctga acacgttcct ggagtcctgc gtcaaccgcc gcgtgcagct ctccgacggc       780
     accaagatgg tggcctccac catcgtgtgg accgccgggg tgaagccgaa cccggtggtg       840
     cagcgcttcg gcgtgccgct gggcgagcgc ggccacgtca aggccggcgc gaccctgcag       900
     gtcgagggct tcgccgacgt ctggtcggcc ggcgacggcg cgcaggtacc ggacctggcc       960
     aaccccggca agtggtgctc cccctcggcg cagcacgcgg tgcgccaggc caagcagctc      1020
     gccgacaacg tggtggcggc cgtccgcggc ttcgaacccc gcgagtacaa gcacaagcac      1080
     gtcggctcgg tggcctccct gggcctgcac aagggcgtcg ccgacgtcta caacatccgg      1140
     ctgcgcggct ggccggcctg gttcatgcac cgcacctacc acatgagccg cgtccccacc      1200
     ttcaaccgca agatccgcgt catcgccgac tggaccctgg ccctgttctt ccgccgcgaa      1260
     gccgtcggcc tgggctccat cgagcgcccg cgcgatgagt tcgccgaggc cgccggcgag      1320
     cagcgcaagg ccgcctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page