(data stored in ACNUC7421 zone)

EMBL: CP001700.PE153

CP001700.PE153       Location/Qualifiers
FT   CDS_pept        complement(163334..164290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0153"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: sma:SAV_3530
FT                   exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69108"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHG9"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ACU69108.1"
FT                   /translation="MTKRVAAIDCGTNSIRLLIADVHPRTGRTEDVVREMRIVRLGEGV
FT                   DATGRLAPAALERTFAACLEYQDLIERHSGGTPIPLRFVATSATRDAENRREFVEGVKG
FT                   ILGVEPYVATGDEEARFSFTGATSELPHDRHQAPYLVIDIGGGSTEFVLGDAERGVIAA
FT                   RSVDMGCVRMYERHLKTAGVATEAQVKAARADIEKLIDRAAEAVPLDEARTLVGLAGTV
FT                   TTLGAVALDLDEYDSERIHLSHIPLGRVRDITTRLLGLTPDERKAIPVIHPGRADVIGA
FT                   GALVLLAIMERVAPSLAAPEVVVSERDILDGIAASIA"
     atgaccaagc gcgtggccgc gatcgactgc ggcaccaact ccatcaggct cctgatcgcc        60
     gacgtccacc cgcgcaccgg caggaccgag gacgtggtgc gcgagatgcg catcgtgcgc       120
     ctcggcgagg gcgtggacgc caccggccgg ctggcgccgg ccgcgctgga gcgcaccttc       180
     gcggcctgtc tggagtacca ggacctgatc gagcggcaca gcggcggcac gccgatcccg       240
     ctgcgcttcg tcgccaccag cgccacccgc gacgccgaga accggcgcga gttcgtcgag       300
     ggcgtcaagg gcatcctcgg ggtcgagccg tacgtggcca cgggcgacga ggaggcgcga       360
     ttctccttca ccggcgccac ctccgagctg ccgcacgacc ggcaccaggc gccctacctg       420
     gtcatcgaca tcggcggcgg gtccacggag ttcgtgctcg gcgacgccga gcgcggcgtg       480
     atcgccgccc gcagcgtcga catgggctgc gtgcggatgt acgagcggca cctgaagacc       540
     gccggcgtcg cgaccgaggc acaggtcaag gccgcgcgcg cggacatcga gaagctgatc       600
     gaccgggccg ccgaggccgt cccgctggac gaggcgcgca ccctggtcgg cctggccggc       660
     accgtgacca cgctcggcgc ggtcgccctg gacctggacg agtacgactc cgagcgcatc       720
     cacctctcgc acatcccgct cggccgggtc cgcgacatca ccacccggct gctcggcctg       780
     acacccgacg aacgcaaggc gatcccggtc atccacccgg ggcgcgccga cgtgatcggc       840
     gccggggcgc tggtgctgct ggcgatcatg gagcgggtcg cgccgagcct ggcggcgccg       900
     gaggtcgtgg tcagcgagcg ggacatcctg gacgggatcg ccgcgagcat cgcctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page