(data stored in ACNUC7421 zone)

EMBL: CP001700.PE154

CP001700.PE154       Location/Qualifiers
FT   CDS_pept        complement(164306..164869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0154"
FT                   /product="protein of unknown function DUF501"
FT                   /note="PFAM: protein of unknown function DUF501; KEGG:
FT                   sco:SCO3094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69109"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH0"
FT                   /inference="protein motif:PFAM:PF04417"
FT                   /protein_id="ACU69109.1"
FT                   /translation="MTNDAPTPDTSRPAPAAAPEADAVSQADLAAVEAQLSRTPRGVRR
FT                   VAHRCPCGNPDVVETAPRLPDGTPFPTLFYLTCPKAASAIGTLEASGLMKEMTERLKTD
FT                   PELAAAYRAADEEYRARRDAIEVLDGFPTAGGMPDRVKCLHVLVGHTLAAGPGVNPLGD
FT                   EALALLPEWWKSGPCVTPSEEPGA"
     atgacgaacg acgctcctac ccccgacacc tcccgacccg cgcccgcggc cgcgccagag        60
     gccgacgctg tcagccaggc cgacctggcc gccgtcgagg cgcagctgag ccgtacgccg       120
     cgcggcgtgc gccgggtcgc gcaccgctgc ccgtgcggca acccggacgt ggtcgagacc       180
     gcgccgcggc tgcccgacgg cacgccgttc ccgacgctgt tctacctgac ctgccccaag       240
     gcggcctcgg cgatcgggac cctggaggcc tcgggcttga tgaaagagat gaccgagcgc       300
     ctgaagaccg atccggaatt ggccgccgcc taccgcgcgg ccgacgagga gtaccgggct       360
     cggcgcgacg ccatcgaagt tctggacggc ttcccgaccg ccggcggcat gccggaccgg       420
     gtgaagtgcc tgcacgtttt ggtcggccac acgctggccg ccggccctgg ggtgaacccg       480
     ctgggcgacg aggcgctggc gctgctcccg gagtggtgga agtccgggcc atgcgtcaca       540
     ccgagcgagg aaccgggtgc atag                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page