(data stored in ACNUC7421 zone)

EMBL: CP001700.PE155

CP001700.PE155       Location/Qualifiers
FT   CDS_pept        165051..165470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69110"
FT                   /db_xref="GOA:C7QHH1"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHH1"
FT                   /inference="similar to AA sequence:KEGG:SACE_1821"
FT                   /protein_id="ACU69110.1"
FT                   /translation="MLPALRVVAVLHALSFIVQPVLAGLFLSGQDTAVDMHATNGMIVV
FT                   TLCLVMTILALPVWRRGLLPRAAFTTSAALLVVEVIQMMVGFTHIMWLHIPLGVLMMGG
FT                   VAQLMPLVMRPYRPSAERTAAAGAVVAFPAVEAGE"
     atgcttccgg ctttgcgcgt ggtggcggta ctccacgcgc tgtccttcat cgtgcagccg        60
     gtcctggccg gcctgttcct gtccggccag gacacggcgg tcgacatgca cgccaccaac       120
     ggcatgatcg tcgtgacgct gtgcctggtc atgacgatcc tcgccctccc ggtctggcgc       180
     cggggtctgc tcccccgcgc ggcgttcacg acgtcggccg ccctgctggt cgtcgaggtg       240
     atccagatga tggtcggctt cacgcacatc atgtggctgc acatcccgct cggcgtgctg       300
     atgatgggcg gcgtcgccca gctcatgccg ctggtgatgc gcccgtaccg gccctcggcc       360
     gagcggactg ccgcagctgg cgcggtcgtg gcgttcccgg ccgtggaggc cggggaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page